SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327398563|ref|YP_004339432.1| from Hippea maritima DSM 10411

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327398563|ref|YP_004339432.1|
Domain Number 1 Region: 510-565
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000312
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327398563|ref|YP_004339432.1|
Sequence length 573
Comment proteinase inhibitor I2 Kunitz metazoa [Hippea maritima DSM 10411]
Sequence
MTEHILKKITLLSILFLLIVNIPAYADMGRIVAYGAKVQENSQKAIIFYNLNEEVLILGT
DLQSGSSSHILRFIPFPSKPRVQLAPKDSFKNIIKVVKKHNLQFIIQYKGVTPTTKSVEI
KLNKKIGAHDLTVIKINSTEHLREWINDFFKSKGLPVKNSYPEVEMVVNSYLNKGINYFA
FDLVKVNKKQRFVQPIEYRFHSKKLYYPLITSNTFGGSGIIDLILISPRTVCNPLESLYE
GCLGVKYLRATTSDSITIDEFNRILPDAKNFFKNKSIFIQMLSYGGSYKFKNDIFVDITN
KYKKAIGYTSNNDSSVYHSFPWEDAVGNKPPVKKPAIYLYPKTKLNINILLNIDGKITKT
VPPYSHIWKITAYPSGNISGGYDYLMYEAQLNSLTLPKSGWVVEYQNLKKWFDTYLFKIG
LNKKEKLQFEEYWLKELPKAKYYEIKLLSGDFLNKHMNIEIKPKPDTFLRFIFYFKPLSK
KIILSEQKIVTPKRVGFTAVEWGGILDKRKNKRCFLYYDRGPCEALFWRYYYNKQENICK
PFIWGGCGGSVPFKTKEECSKACISKLLVKGGN
Download sequence
Identical sequences F2LTX4
gi|327398563|ref|YP_004339432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]