SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433638863|ref|YP_007284623.1| from Halovivax ruber XH-70

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433638863|ref|YP_007284623.1|
Domain Number 1 Region: 17-77,113-246,275-314
Classification Level Classification E-value
Superfamily PP2C-like 3.4e-34
Family PP2C-like 0.00097
Further Details:      
 
Weak hits

Sequence:  gi|433638863|ref|YP_007284623.1|
Domain Number - Region: 433-497
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00478
Family FHA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|433638863|ref|YP_007284623.1|
Sequence length 582
Comment serine/threonine protein phosphatase [Halovivax ruber XH-70]
Sequence
MEHASTVDIGRRKREANGINEDSVATTILENHHRGTSRSVGLFVLGDGVGGEASGDVASF
LTTSVVRAHLTEALLGDGTDRPEQYAIDAYDETPPTVSETDDDGTSPLSESRIRTAIQEA
IDEAHAHVQQYARDVGARPATTVVAAVYADGRLHYGWVGDSRLYVLNRDHETIEQLTRDH
AVTNDLLERGEIDHDEHARVHEDATAITNAVGGSGHGKPSVDVEFGSVPVYRDDVILLTS
DGLIDAFPDIAPLRAAYEAATDTEAVRADIRDTLVTDDEIRDIVLGADDLSDAVEELIDF
ANDRGGKDNLSISLASDPAAAETPDRPPARGIGSDSPGLVDQETEIESPARSASDEGGSA
GDGDSTAATIAEASADPEASSGTPESSTDTSSTPESSAPSTADDDPLVPDEHVVTLCDGE
PPTAAIAVVGEDRVFEVGDGVTIGCVTDTADDGPDIGLDVGPDGIVEPAHTTIGYDEDAD
AWTVRDSSSSGTYVEAAPGEWVLLLSAEGVELHREHGFDPGAAAEEAISATTTIEDGTAF
TLQDPRSTETVTFQFFRSVADARDRRNRPDETGESAFEQFIV
Download sequence
Identical sequences L0IA71
gi|433638863|ref|YP_007284623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]