SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197333990|ref|YP_002154875.1| from Vibrio fischeri MJ11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197333990|ref|YP_002154875.1|
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.72e-70
Family Nucleotide and nucleoside kinases 0.000000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197333990|ref|YP_002154875.1|
Sequence length 207
Comment guanylate kinase [Vibrio fischeri MJ11]
Sequence
MSKGTLYIVSAPSGAGKSSLISALLESNPTYAMKVSVSHTTRGMRPGETDGVHYHFIQKE
HFEELIQKGEFLEYAEVFGNYYGTSRVWIEETLDKGIDVFLDIDWQGARQIREQMPLAKS
VFILPPSNGELERRLNARGQDSDAVIAKRMSEAKSEISHYDEYDYVIINDDFDTAQMDFR
SIIRAERLKQDKQTMKYKGMLEALLAD
Download sequence
Identical sequences A0A1B9PA76 B5FFD7
388396.VFMJ11_0104 WP_005417000.1.102040 WP_005417000.1.198 WP_005417000.1.21686 WP_005417000.1.31530 WP_005417000.1.32349 WP_005417000.1.34024 WP_005417000.1.3463 WP_005417000.1.44395 WP_005417000.1.47877 WP_005417000.1.62330 WP_005417000.1.66091 WP_005417000.1.76599 WP_005417000.1.77059 WP_005417000.1.81434 WP_005417000.1.82276 WP_005417000.1.85856 WP_005417000.1.93430 WP_005417000.1.94618 WP_005417000.1.97281 gi|197333990|ref|YP_002154875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]