SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197337904|ref|YP_002158588.1| from Vibrio fischeri MJ11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197337904|ref|YP_002158588.1|
Domain Number 1 Region: 12-305
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.07e-28
Family Thioesterases 0.00000000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197337904|ref|YP_002158588.1|
Sequence length 307
Comment acyl transferase [Vibrio fischeri MJ11]
Sequence
MKDESALFTIDHIIKLDNGQSIRVWETLPKKNVPEKKNTILIASGFARRMDHFAGLAEYL
STNGFHVIRYDSLHHVGLSSGCINEFTMSIGKNSLLTVVDWLTDHGVERIGLIAASLSAR
IAYEVVNKIKLSFLITAVGVVNLRDTLEKALEYDYLQLPISELPEDLDFEGHNLGSEVFV
TDCFKHDWDTLDSTLNSVKGLAIPFIAFTANDDSWVKQSEVIELIDSIESSNCKLYSLIG
SSHDLGENLVVLRNFYQSVTKAALALDDGLLDLEIDIIEPRFEDVTSITVKERRLKNEIE
NELLELA
Download sequence
Identical sequences B5EV70
gi|197337904|ref|YP_002158588.1| 388396.VFMJ11_A1040 WP_012535652.1.44395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]