SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|189501785|ref|YP_001957502.1| from Candidatus Amoebophilus asiaticus 5a2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|189501785|ref|YP_001957502.1|
Domain Number 1 Region: 455-564
Classification Level Classification E-value
Superfamily BAG domain 1.83e-27
Family BAG domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|189501785|ref|YP_001957502.1|
Sequence length 627
Comment hypothetical protein Aasi_0346 [Candidatus Amoebophilus asiaticus 5a2]
Sequence
MYNTNKRIIAVILLCSQLLTTTSCSGNFGVPTQQEVTQEHKQVEKKHRKREDLSVSLPTE
LSLYTTEGEAKKSALVDESVTKQLQLVESNLDYSKALAPTIADNLSSVSLKEEQPSVVSR
PKPIVTPIKSSRPSSDSGKPSGYTTSTDASKTLQAAMKEKKTIRKELMVPPASGIAISEQ
VTESQSPLMLIAKGGHQVYVDHASGEKAIVVANVPTKSDKYHRLQLPLVYQSANIDLLSL
SKQPVSYQQNRVRICFPSVDTKGIGYVSVEDYGLKGGGRLSIDADEIIQAITRGYGTLGR
EPETMADWRSFLITFAQGLSSINLELTSVNNPSSFDPGNMRNIFLHMARSITGRNVQLEN
YGEAWSSIVGQARNKLRQHQRLNIDPSAYPRDSYTIVLRPNASRMRPFIGEMDRIYSTSN
ASESVRLNFDNILGAVDVEINLEATFRFFEDIQIERQENERRDQVRRIVDRVVGEVESIE
SDFINIKSHLQGLNLTDPSSSEDVKKIINTLKQQHEVLMRKLTVLDDLAGADEETRVKRK
SLVGKVSSMLDEIDRFLRELHEALEKQQRQKNGGTWDSVTDGRISELYSDVQGPATNFIN
QTESEINNPAACGGVIYSLLFPSLAFV
Download sequence
Identical sequences B3ERC1
452471.Aasi_0346 WP_012472534.1.36742 gi|189501785|ref|YP_001957502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]