SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288645|ref|YP_002223551.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288645|ref|YP_002223551.1|
Domain Number 1 Region: 38-337
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.96e-81
Family Variable surface antigen VlsE 0.00000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|203288645|ref|YP_002223551.1|
Sequence length 342
Comment vlp protein, delta subfamily [Borrelia duttonii Ly]
Sequence
MNIEKKGEGKVRVIIVMMVMMMVMMGCNSGGRDPEKVFLSEMVNLGKGFLDVFVSFGDMI
TGTLGIKAETKKSEIGKCFSDVEKTMQTTKVKLNEILEKHGKYEKVKTVVEQFISGIIEK
IAAGAKEAASGATSDGAIGNSKANEDASPAEAGSVNKLVKGIKEIVKVVLEGKGNPEATK
TAEAERKSIGKLLSGKGANDGEEKHAAAASASIGAVSGADILQAIAKSVETAGGVDIDQA
KDAASIAASKKDNAADFAAARNDAMIAGGIALRAMAKDGKLSAKTGEDKSAHAINGAVAS
AVNKVLSTLVIGIRNRVDEGLKEINKVLGEIKQGEISEAKTN
Download sequence
Identical sequences B5RNZ1
WP_012539476.1.78452 gi|203288645|ref|YP_002223551.1|NC_011248 gi|203288645|ref|YP_002223551.1| 412419.BDU_7005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]