SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288648|ref|YP_002223554.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288648|ref|YP_002223554.1|
Domain Number 1 Region: 64-373
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.62e-68
Family Variable surface antigen VlsE 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|203288648|ref|YP_002223554.1|
Sequence length 390
Comment vlp protein, gamma subfamily [Borrelia duttonii Ly]
Sequence
MNREVKEGEIKEIGIERVRERGNRMDKMWDRMRIKGIILMMMMVMMMMGCNSGGVGEAEQ
GKNKFLQSLVNVSEEFLNVFTSFGEMVGSVLGLKADSKKSDVAAYFKTVQDTVQGAKDGL
NKIVAEMKKESNPHAAATETAVKKLVSETLDKIITGAKTASEAIGGDANDFIGNVAAGGA
NGAGAGAKGDGVENLVKGIKSIVDIVLKNKGSAEAGDGKKADALGARGNNAGDAGKLFGN
TDNNGAIAADAKKAAADAAKAVGAVTGADILQAISKNNGDSAKLANHNASAQVTGVASDI
KDAVIAGGIALRAMAKGGKFANEKDNANNDVVTAVRGAAVSAVSKALDTLTIAIREAMDL
GLKEIKKVMKINNDTPVATSEKSGSGVKNQ
Download sequence
Identical sequences B5RNZ4
gi|203288648|ref|YP_002223554.1|NC_011248 412419.BDU_7012 WP_012539479.1.78452 gi|203288648|ref|YP_002223554.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]