SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288703|ref|YP_002223606.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288703|ref|YP_002223606.1|
Domain Number 1 Region: 34-336
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.62e-85
Family Variable surface antigen VlsE 0.00000766
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|203288703|ref|YP_002223606.1|
Sequence length 343
Comment vlp protein, delta subfamily [Borrelia duttonii Ly]
Sequence
MKIEKKVEGKIRVIIMMVMMGCNSGGVKDPEKVFLSEMVNLGKGFLDVFVSFGDMITGTL
GIKAETKKSEIGGYFSKIAETMKEVREKLEKIVGEYGNYEKVKGKVEEFIGRIGKIEEGA
KEAALGASGNDTIGNAVKDQAAKAADITSVSKLVKGIKGIVGMVLGEKEGNADNNVITEE
KKDIGKLFGKKDDDRTQEAEAAKANASIGTVSGADILKAMSQSNEDLKADNTNGIEAAKD
AAEIAIASAVDNKKEIKDPAKKDAVIAAGIALRAMAKDGKFAAKQDASDKYANAVNGVVA
NAVSKVLSTLTIAIRNRVDEGLKEINKVLGEIQQGEIFEAKSN
Download sequence
Identical sequences B5RP46
WP_012539531.1.78452 gi|203288703|ref|YP_002223606.1| 412419.BDU_4002 gi|203288703|ref|YP_002223606.1|NC_011251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]