SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288719|ref|YP_002223622.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288719|ref|YP_002223622.1|
Domain Number 1 Region: 61-357
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.48e-65
Family Variable surface antigen VlsE 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|203288719|ref|YP_002223622.1|
Sequence length 374
Comment vlp protein, gamma subfamily [Borrelia duttonii Ly]
Sequence
MKEGKIKGEIEGYREKRGEIMRGGKMRVRRVVKGIIMRMFVVVMGCNSGGVGGVEEGKNK
YLQSLVNVSNEFLNVFTSFGEMVGSVLGLKADSKKSDVGNYFKTVQGTVEGVKTGLNKIV
SEMKKEKNPNAEATATAVKTLVENTLDKIIEGAKVASEAIGNAGDPIGNIAPAAAGGGAG
VAGFEIDSLVKGIKSIVNVVIRDGNAEAGDANKAEDGKTERTAAGDNEAGKLFASDNAGD
SADKAKKVAADAAKAVGAVTGADILQAIVKNGSNAATNATKAKAKDGTIAGAIALRAMTK
GGKFANASAADNEGVITSAVKGAAISAVTKALDTLTVAIRKTIDLGLKEVKNVMKINNDT
PLASEQSDSGGQNQ
Download sequence
Identical sequences B5RP62
WP_012539547.1.78452 gi|203288719|ref|YP_002223622.1|NC_011251 gi|203288883|ref|YP_002223876.1|NC_011262 412419.BDU_4026 412419.BDU_9027 gi|203288719|ref|YP_002223622.1| gi|203288883|ref|YP_002223876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]