SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288732|ref|YP_002223668.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288732|ref|YP_002223668.1|
Domain Number 1 Region: 24-322
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.06e-66
Family Variable surface antigen VlsE 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|203288732|ref|YP_002223668.1|
Sequence length 339
Comment vlp protein, gamma subfamily [Borrelia duttonii Ly]
Sequence
MMVVVMVMVCNSGGVAEGEEGKNKFLQSLVNVSNEFLNVFTSFGEMVGSVLGLNVNSKKS
DVRNYFKKVQETVQGIKYGLNKIVADMKEEKNPNVEATESAVKTLVENTLDKIIEGAKTA
SEAIGDASGLIGNVADQNGTGVAGTDVDKLVEGIKGIVKVVLEGVGKADAGDSNKASDGT
ARTANAGDGEAGKLFITGNGAAGDDANSKKVATDAAKAVGGVRGSDILQAIVKEGGDASK
LATAQNPGSAPKDAVIAGGIALRAMAKGGKFANGAANSDVSAAVKGAAVSAVTKALDILT
IGIRRAIDLGLKSVKEAMKTNTGATAIASGKSGSSSQNQ
Download sequence
Identical sequences B5RP74
gi|203288732|ref|YP_002223668.1| gi|203288732|ref|YP_002223668.1|NC_011254 WP_012539592.1.78452 412419.BDU_3004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]