SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288733|ref|YP_002223669.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288733|ref|YP_002223669.1|
Domain Number 1 Region: 42-344
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.83e-72
Family Variable surface antigen VlsE 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203288733|ref|YP_002223669.1|
Sequence length 361
Comment vlp protein, beta subfamily [Borrelia duttonii Ly]
Sequence
MNIEKKGEGKVRVILLMMMMVMMGCNSGGVKGGEVNLEAKNSFLESLIKIGEGFQEIFDV
FGSAVGDALGFSVVKAGDKRSKVGEHFEKIGKGLQVIKDKLNGLAKDIASAPYVDSKGVE
SIINSASEVIVKLIASVTKLAGVTKEDTIIDNAGTAGNAAAVAAEEASVKAIIEEVKAII
EIAMNSGVKIEKGNAGNSVANGNGPKAVVHNAQASAGDATKLVDEVAKADPWAMIDKIKS
AKTKNNVAPAANDDAGQLATATGANDNGSASTNADLAASVALKAMTKGGKFTQPAANEDG
AIKAAAASAVNKVLGILDVIINKAVNLEFNKVKEAVKGIKYAETVGTEIVKSSTIQSIVT
K
Download sequence
Identical sequences B5RP75
gi|203288733|ref|YP_002223669.1| gi|203288733|ref|YP_002223669.1|NC_011254 412419.BDU_3006 WP_012539593.1.78452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]