SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288706|ref|YP_002223609.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288706|ref|YP_002223609.1|
Domain Number 1 Region: 110-405
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.23e-40
Family Variable surface antigen VlsE 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203288706|ref|YP_002223609.1|
Sequence length 416
Comment vlp protein [Borrelia duttonii Ly]
Sequence
MNKYNHYMKYKKGLAENDKQILSSKARSSKPLSINQRVAQELAEVKAKNQILREAIRLNE
IDSLSKKYLNSHFNKEVMVKFVIMMMMVMGCNSGGVKEVEEVGLQEVGGLKLGDTTKSIF
SAFVDLITNSLGISVTNSTKKSDISDKFKDLVNAIDKAINQVQEVASKVGINVEESQDGS
IGQAKKTLNELKKHITSLQTLINESMVVSGVTANVATAVEGVGSSVEDVKGALKALKGIV
NFSVKKSTVSKNETVSNEEKEGGKVLKTTGGGGAVEGDAAKALSIVTSVTGEDMLYAITS
AEDSDVVAETTISSATQPKHAVKLAVTGAATTADNAQNASKLALAGGIALRSLLKGGKLD
ASAAKTSTNAVNGVGVSAVNKLLKAIESITKIIVSQCLEQTEQILLKSNRKAFNYI
Download sequence
Identical sequences B5RP49
gi|203288706|ref|YP_002223609.1|NC_011251 412419.BDU_4007 gi|203288706|ref|YP_002223609.1| WP_012539534.1.78452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]