SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288826|ref|YP_002223793.1| from Borrelia duttonii Ly

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288826|ref|YP_002223793.1|
Domain Number 1 Region: 148-428
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.22e-45
Family Variable surface antigen VlsE 0.00025
Further Details:      
 
Weak hits

Sequence:  gi|203288826|ref|YP_002223793.1|
Domain Number - Region: 115-153
Classification Level Classification E-value
Superfamily Methionine synthase domain 0.0183
Family Methionine synthase domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|203288826|ref|YP_002223793.1|
Sequence length 433
Comment vlp protein, beta subfamily [Borrelia duttonii Ly]
Sequence
MKKPLGLLIIINLFMGCDSNSILGLGKLIDKHKDTGSNILGLDKLSDESKDALLDSALTI
GQEMVQVGKEIGPRVVNMGEEVVSGTLELGQDILEIGQKAGEMIIPGVLQAGQVILPGAI
QAGQLILSEVFETGKIVVPELLETGKVIGQGFQDIFWFVGNVVGDMLEDLLVKADIKSTD
KRNKIKEHFEKVKTQLEAIKKSKLGDSSEVLSKLITAVEKLANAVGGDDIGIGEVSNSAT
WSSIMSNKESVQSIIDGIKEIVELAEKSGITVESGNAGDFVAASAQTAAPAALNGGHAGA
KPGAGIKLAEEVSKADPWAIIDKIRKSKVSTETGYMSGNKKAGELITGKTSGGIGVGAET
NADFAAAVALKAMSKDGKFAVYAKDASSNDANKVKEAATEAVNKVLDTLGLIIRRTVRME
IGKGNKKVIDQKS
Download sequence
Identical sequences B5RNM7
412419.BDU_14007 WP_012539712.1.78452 gi|203288826|ref|YP_002223793.1|NC_011259 gi|203288826|ref|YP_002223793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]