SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218891846|ref|YP_002440713.1| from Pseudomonas aeruginosa LESB58

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218891846|ref|YP_002440713.1|
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.76e-61
Family PA2201 N-terminal domain-like 0.00000025
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 4.68e-44
Family PA2201 C-terminal domain-like 0.0000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218891846|ref|YP_002440713.1|
Sequence length 294
Comment hypothetical protein PLES_31241 [Pseudomonas aeruginosa LESB58]
Sequence
MHAFPLTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQ
PFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGA
ARDSLREQGEVDFETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRL
LDYLGAAALGLTSASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKA
QKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARARGDA
Download sequence
Identical sequences A0A0D7MBS8 A0A1F0IIU5 A0A1G5IRB8 Q9I1R6
2fefA gi|568154269|ref|YP_008943248.1| gi|218891846|ref|YP_002440713.1| 208964.PA2201 557722.PLES_31241 gi|514409556|ref|YP_008132716.1| NP_250891.1.87394 WP_003113693.1.100179 WP_003113693.1.100394 WP_003113693.1.100473 WP_003113693.1.100523 WP_003113693.1.100654 WP_003113693.1.100723 WP_003113693.1.100742 WP_003113693.1.100777 WP_003113693.1.100808 WP_003113693.1.100809 WP_003113693.1.100872 WP_003113693.1.100983 WP_003113693.1.101021 WP_003113693.1.101506 WP_003113693.1.101572 WP_003113693.1.101642 WP_003113693.1.101712 WP_003113693.1.10179 WP_003113693.1.101809 WP_003113693.1.101819 WP_003113693.1.101863 WP_003113693.1.10201 WP_003113693.1.10202 WP_003113693.1.10204 WP_003113693.1.10228 WP_003113693.1.1037 WP_003113693.1.10407 WP_003113693.1.10457 WP_003113693.1.10468 WP_003113693.1.10482 WP_003113693.1.10513 WP_003113693.1.10636 WP_003113693.1.10684 WP_003113693.1.10901 WP_003113693.1.10949 WP_003113693.1.11026 WP_003113693.1.11058 WP_003113693.1.1109 WP_003113693.1.11178 WP_003113693.1.11381 WP_003113693.1.11388 WP_003113693.1.11410 WP_003113693.1.11417 WP_003113693.1.11454 WP_003113693.1.11569 WP_003113693.1.1187 WP_003113693.1.11943 WP_003113693.1.12018 WP_003113693.1.12120 WP_003113693.1.1238 WP_003113693.1.12497 WP_003113693.1.12530 WP_003113693.1.12561 WP_003113693.1.12657 WP_003113693.1.12670 WP_003113693.1.12797 WP_003113693.1.12980 WP_003113693.1.13057 WP_003113693.1.13092 WP_003113693.1.13232 WP_003113693.1.13242 WP_003113693.1.13315 WP_003113693.1.13407 WP_003113693.1.13785 WP_003113693.1.13795 WP_003113693.1.13828 WP_003113693.1.13865 WP_003113693.1.1393 WP_003113693.1.14049 WP_003113693.1.14078 WP_003113693.1.14096 WP_003113693.1.14204 WP_003113693.1.14378 WP_003113693.1.14460 WP_003113693.1.14463 WP_003113693.1.14564 WP_003113693.1.14714 WP_003113693.1.1475 WP_003113693.1.14966 WP_003113693.1.15222 WP_003113693.1.15231 WP_003113693.1.15281 WP_003113693.1.15297 WP_003113693.1.15373 WP_003113693.1.15379 WP_003113693.1.15480 WP_003113693.1.15482 WP_003113693.1.15602 WP_003113693.1.15692 WP_003113693.1.15886 WP_003113693.1.15934 WP_003113693.1.16041 WP_003113693.1.16074 WP_003113693.1.16142 WP_003113693.1.16197 WP_003113693.1.162 WP_003113693.1.16267 WP_003113693.1.1646 WP_003113693.1.16660 WP_003113693.1.16694 WP_003113693.1.16782 WP_003113693.1.16788 WP_003113693.1.16801 WP_003113693.1.17022 WP_003113693.1.17155 WP_003113693.1.17162 WP_003113693.1.17353 WP_003113693.1.1739 WP_003113693.1.17397 WP_003113693.1.17697 WP_003113693.1.17890 WP_003113693.1.18052 WP_003113693.1.18117 WP_003113693.1.18199 WP_003113693.1.18204 WP_003113693.1.18234 WP_003113693.1.1824 WP_003113693.1.18493 WP_003113693.1.18653 WP_003113693.1.18728 WP_003113693.1.18735 WP_003113693.1.18769 WP_003113693.1.18911 WP_003113693.1.18930 WP_003113693.1.19251 WP_003113693.1.19260 WP_003113693.1.19376 WP_003113693.1.1938 WP_003113693.1.19591 WP_003113693.1.19703 WP_003113693.1.19711 WP_003113693.1.19741 WP_003113693.1.19931 WP_003113693.1.20024 WP_003113693.1.20070 WP_003113693.1.20125 WP_003113693.1.20134 WP_003113693.1.20216 WP_003113693.1.20342 WP_003113693.1.20682 WP_003113693.1.20854 WP_003113693.1.21100 WP_003113693.1.21166 WP_003113693.1.21471 WP_003113693.1.21517 WP_003113693.1.21718 WP_003113693.1.21744 WP_003113693.1.21767 WP_003113693.1.21801 WP_003113693.1.21863 WP_003113693.1.21871 WP_003113693.1.21891 WP_003113693.1.221 WP_003113693.1.2228 WP_003113693.1.22324 WP_003113693.1.22389 WP_003113693.1.22394 WP_003113693.1.22442 WP_003113693.1.22477 WP_003113693.1.22491 WP_003113693.1.22573 WP_003113693.1.22671 WP_003113693.1.22704 WP_003113693.1.22729 WP_003113693.1.22863 WP_003113693.1.23013 WP_003113693.1.23195 WP_003113693.1.2323 WP_003113693.1.23394 WP_003113693.1.23418 WP_003113693.1.23523 WP_003113693.1.23525 WP_003113693.1.23559 WP_003113693.1.23611 WP_003113693.1.23715 WP_003113693.1.23739 WP_003113693.1.23769 WP_003113693.1.23794 WP_003113693.1.23884 WP_003113693.1.23925 WP_003113693.1.23967 WP_003113693.1.24077 WP_003113693.1.24087 WP_003113693.1.24101 WP_003113693.1.24351 WP_003113693.1.24447 WP_003113693.1.2453 WP_003113693.1.24662 WP_003113693.1.24851 WP_003113693.1.24862 WP_003113693.1.24869 WP_003113693.1.24879 WP_003113693.1.24938 WP_003113693.1.25052 WP_003113693.1.25067 WP_003113693.1.25075 WP_003113693.1.251 WP_003113693.1.2511 WP_003113693.1.25142 WP_003113693.1.25179 WP_003113693.1.25271 WP_003113693.1.25328 WP_003113693.1.25344 WP_003113693.1.25600 WP_003113693.1.25695 WP_003113693.1.2572 WP_003113693.1.25903 WP_003113693.1.2596 WP_003113693.1.25964 WP_003113693.1.26025 WP_003113693.1.26159 WP_003113693.1.26334 WP_003113693.1.26428 WP_003113693.1.26463 WP_003113693.1.26489 WP_003113693.1.2652 WP_003113693.1.26604 WP_003113693.1.26681 WP_003113693.1.26682 WP_003113693.1.26705 WP_003113693.1.26740 WP_003113693.1.26816 WP_003113693.1.26841 WP_003113693.1.26906 WP_003113693.1.26967 WP_003113693.1.27028 WP_003113693.1.27107 WP_003113693.1.27211 WP_003113693.1.27259 WP_003113693.1.27687 WP_003113693.1.27783 WP_003113693.1.27837 WP_003113693.1.27858 WP_003113693.1.27966 WP_003113693.1.28057 WP_003113693.1.28064 WP_003113693.1.28136 WP_003113693.1.28258 WP_003113693.1.283 WP_003113693.1.28316 WP_003113693.1.28329 WP_003113693.1.28372 WP_003113693.1.28382 WP_003113693.1.28383 WP_003113693.1.28404 WP_003113693.1.28528 WP_003113693.1.28560 WP_003113693.1.28602 WP_003113693.1.28800 WP_003113693.1.28823 WP_003113693.1.28838 WP_003113693.1.28920 WP_003113693.1.29062 WP_003113693.1.29096 WP_003113693.1.29137 WP_003113693.1.29158 WP_003113693.1.2927 WP_003113693.1.29438 WP_003113693.1.2948 WP_003113693.1.29498 WP_003113693.1.2961 WP_003113693.1.29668 WP_003113693.1.29753 WP_003113693.1.29767 WP_003113693.1.2980 WP_003113693.1.29958 WP_003113693.1.30081 WP_003113693.1.30254 WP_003113693.1.30365 WP_003113693.1.30474 WP_003113693.1.30625 WP_003113693.1.3072 WP_003113693.1.30740 WP_003113693.1.30797 WP_003113693.1.30815 WP_003113693.1.30973 WP_003113693.1.30994 WP_003113693.1.31279 WP_003113693.1.31361 WP_003113693.1.31587 WP_003113693.1.31741 WP_003113693.1.3179 WP_003113693.1.31848 WP_003113693.1.3189 WP_003113693.1.32134 WP_003113693.1.32144 WP_003113693.1.32314 WP_003113693.1.32523 WP_003113693.1.32544 WP_003113693.1.32711 WP_003113693.1.32869 WP_003113693.1.32879 WP_003113693.1.33186 WP_003113693.1.33204 WP_003113693.1.33210 WP_003113693.1.33340 WP_003113693.1.33387 WP_003113693.1.3351 WP_003113693.1.33517 WP_003113693.1.33521 WP_003113693.1.33523 WP_003113693.1.33549 WP_003113693.1.33653 WP_003113693.1.3376 WP_003113693.1.33801 WP_003113693.1.33822 WP_003113693.1.34039 WP_003113693.1.34136 WP_003113693.1.34151 WP_003113693.1.34191 WP_003113693.1.34317 WP_003113693.1.34324 WP_003113693.1.34401 WP_003113693.1.34472 WP_003113693.1.3452 WP_003113693.1.34568 WP_003113693.1.34670 WP_003113693.1.34689 WP_003113693.1.34784 WP_003113693.1.34821 WP_003113693.1.34832 WP_003113693.1.34836 WP_003113693.1.34837 WP_003113693.1.34878 WP_003113693.1.34922 WP_003113693.1.34942 WP_003113693.1.35036 WP_003113693.1.35149 WP_003113693.1.35231 WP_003113693.1.35353 WP_003113693.1.3540 WP_003113693.1.35431 WP_003113693.1.35480 WP_003113693.1.35512 WP_003113693.1.35599 WP_003113693.1.35639 WP_003113693.1.35669 WP_003113693.1.3568 WP_003113693.1.35762 WP_003113693.1.35822 WP_003113693.1.35843 WP_003113693.1.35857 WP_003113693.1.35984 WP_003113693.1.36266 WP_003113693.1.36378 WP_003113693.1.36435 WP_003113693.1.36487 WP_003113693.1.36521 WP_003113693.1.3653 WP_003113693.1.36608 WP_003113693.1.3662 WP_003113693.1.36665 WP_003113693.1.3672 WP_003113693.1.37097 WP_003113693.1.37125 WP_003113693.1.37216 WP_003113693.1.37319 WP_003113693.1.37500 WP_003113693.1.3781 WP_003113693.1.37826 WP_003113693.1.3785 WP_003113693.1.38087 WP_003113693.1.38186 WP_003113693.1.3821 WP_003113693.1.3833 WP_003113693.1.38430 WP_003113693.1.38502 WP_003113693.1.38505 WP_003113693.1.3870 WP_003113693.1.38727 WP_003113693.1.38834 WP_003113693.1.39046 WP_003113693.1.39088 WP_003113693.1.39122 WP_003113693.1.39326 WP_003113693.1.39452 WP_003113693.1.39458 WP_003113693.1.39704 WP_003113693.1.39811 WP_003113693.1.39989 WP_003113693.1.40059 WP_003113693.1.40135 WP_003113693.1.40207 WP_003113693.1.40213 WP_003113693.1.40419 WP_003113693.1.40513 WP_003113693.1.40546 WP_003113693.1.4058 WP_003113693.1.40595 WP_003113693.1.40703 WP_003113693.1.40950 WP_003113693.1.40994 WP_003113693.1.41412 WP_003113693.1.41492 WP_003113693.1.41502 WP_003113693.1.41624 WP_003113693.1.41692 WP_003113693.1.41773 WP_003113693.1.41846 WP_003113693.1.41871 WP_003113693.1.41939 WP_003113693.1.42019 WP_003113693.1.42041 WP_003113693.1.42259 WP_003113693.1.42294 WP_003113693.1.42463 WP_003113693.1.42508 WP_003113693.1.42634 WP_003113693.1.42643 WP_003113693.1.42696 WP_003113693.1.42778 WP_003113693.1.42854 WP_003113693.1.42946 WP_003113693.1.42952 WP_003113693.1.42973 WP_003113693.1.43024 WP_003113693.1.43049 WP_003113693.1.43106 WP_003113693.1.43107 WP_003113693.1.43356 WP_003113693.1.4348 WP_003113693.1.43603 WP_003113693.1.43662 WP_003113693.1.43811 WP_003113693.1.44046 WP_003113693.1.44094 WP_003113693.1.44373 WP_003113693.1.44434 WP_003113693.1.445 WP_003113693.1.44563 WP_003113693.1.44739 WP_003113693.1.44760 WP_003113693.1.4493 WP_003113693.1.45063 WP_003113693.1.45090 WP_003113693.1.45202 WP_003113693.1.45312 WP_003113693.1.45328 WP_003113693.1.45358 WP_003113693.1.45478 WP_003113693.1.45485 WP_003113693.1.45711 WP_003113693.1.45723 WP_003113693.1.45818 WP_003113693.1.45920 WP_003113693.1.45934 WP_003113693.1.45961 WP_003113693.1.46010 WP_003113693.1.46032 WP_003113693.1.46152 WP_003113693.1.46200 WP_003113693.1.46436 WP_003113693.1.46502 WP_003113693.1.46826 WP_003113693.1.46846 WP_003113693.1.4699 WP_003113693.1.47150 WP_003113693.1.47155 WP_003113693.1.47251 WP_003113693.1.4726 WP_003113693.1.47296 WP_003113693.1.47312 WP_003113693.1.47469 WP_003113693.1.47480 WP_003113693.1.47598 WP_003113693.1.47645 WP_003113693.1.47774 WP_003113693.1.47930 WP_003113693.1.48024 WP_003113693.1.48094 WP_003113693.1.48172 WP_003113693.1.48178 WP_003113693.1.48321 WP_003113693.1.48334 WP_003113693.1.4836 WP_003113693.1.48382 WP_003113693.1.48413 WP_003113693.1.48474 WP_003113693.1.48576 WP_003113693.1.48870 WP_003113693.1.49135 WP_003113693.1.49266 WP_003113693.1.49277 WP_003113693.1.49293 WP_003113693.1.49416 WP_003113693.1.49557 WP_003113693.1.49833 WP_003113693.1.49842 WP_003113693.1.49976 WP_003113693.1.49988 WP_003113693.1.50567 WP_003113693.1.50653 WP_003113693.1.50668 WP_003113693.1.50682 WP_003113693.1.50734 WP_003113693.1.50814 WP_003113693.1.50967 WP_003113693.1.51035 WP_003113693.1.51136 WP_003113693.1.51141 WP_003113693.1.51273 WP_003113693.1.5132 WP_003113693.1.51538 WP_003113693.1.51549 WP_003113693.1.51585 WP_003113693.1.51682 WP_003113693.1.51847 WP_003113693.1.51937 WP_003113693.1.51976 WP_003113693.1.52043 WP_003113693.1.52146 WP_003113693.1.52152 WP_003113693.1.5226 WP_003113693.1.52326 WP_003113693.1.52334 WP_003113693.1.52690 WP_003113693.1.52728 WP_003113693.1.52810 WP_003113693.1.53070 WP_003113693.1.53267 WP_003113693.1.53351 WP_003113693.1.53371 WP_003113693.1.53486 WP_003113693.1.53530 WP_003113693.1.53663 WP_003113693.1.53726 WP_003113693.1.53826 WP_003113693.1.53948 WP_003113693.1.54078 WP_003113693.1.54090 WP_003113693.1.54146 WP_003113693.1.5420 WP_003113693.1.54248 WP_003113693.1.5427 WP_003113693.1.54462 WP_003113693.1.54497 WP_003113693.1.54974 WP_003113693.1.55318 WP_003113693.1.55347 WP_003113693.1.55400 WP_003113693.1.55478 WP_003113693.1.55543 WP_003113693.1.55729 WP_003113693.1.56013 WP_003113693.1.56145 WP_003113693.1.56171 WP_003113693.1.56187 WP_003113693.1.56188 WP_003113693.1.56229 WP_003113693.1.56348 WP_003113693.1.56442 WP_003113693.1.56474 WP_003113693.1.56623 WP_003113693.1.56745 WP_003113693.1.56797 WP_003113693.1.56808 WP_003113693.1.56837 WP_003113693.1.56864 WP_003113693.1.57113 WP_003113693.1.57131 WP_003113693.1.57140 WP_003113693.1.57460 WP_003113693.1.57532 WP_003113693.1.57548 WP_003113693.1.57566 WP_003113693.1.57728 WP_003113693.1.57839 WP_003113693.1.58019 WP_003113693.1.58056 WP_003113693.1.58155 WP_003113693.1.58162 WP_003113693.1.58294 WP_003113693.1.58436 WP_003113693.1.58482 WP_003113693.1.58785 WP_003113693.1.58838 WP_003113693.1.58845 WP_003113693.1.5889 WP_003113693.1.59013 WP_003113693.1.59076 WP_003113693.1.59099 WP_003113693.1.59176 WP_003113693.1.59250 WP_003113693.1.5937 WP_003113693.1.594 WP_003113693.1.59469 WP_003113693.1.59759 WP_003113693.1.59797 WP_003113693.1.59831 WP_003113693.1.60051 WP_003113693.1.60062 WP_003113693.1.60082 WP_003113693.1.60085 WP_003113693.1.60206 WP_003113693.1.60261 WP_003113693.1.60347 WP_003113693.1.60415 WP_003113693.1.60467 WP_003113693.1.60603 WP_003113693.1.60639 WP_003113693.1.607 WP_003113693.1.60910 WP_003113693.1.61122 WP_003113693.1.61191 WP_003113693.1.61299 WP_003113693.1.61366 WP_003113693.1.61431 WP_003113693.1.61493 WP_003113693.1.61696 WP_003113693.1.6173 WP_003113693.1.61943 WP_003113693.1.62035 WP_003113693.1.62180 WP_003113693.1.62186 WP_003113693.1.62211 WP_003113693.1.62357 WP_003113693.1.62396 WP_003113693.1.6242 WP_003113693.1.62516 WP_003113693.1.62534 WP_003113693.1.62688 WP_003113693.1.62701 WP_003113693.1.6280 WP_003113693.1.62917 WP_003113693.1.63041 WP_003113693.1.63057 WP_003113693.1.63124 WP_003113693.1.63193 WP_003113693.1.63338 WP_003113693.1.63369 WP_003113693.1.63634 WP_003113693.1.63659 WP_003113693.1.63995 WP_003113693.1.64139 WP_003113693.1.64155 WP_003113693.1.64198 WP_003113693.1.64309 WP_003113693.1.64433 WP_003113693.1.64591 WP_003113693.1.64603 WP_003113693.1.64726 WP_003113693.1.64748 WP_003113693.1.64799 WP_003113693.1.64854 WP_003113693.1.64885 WP_003113693.1.64983 WP_003113693.1.65009 WP_003113693.1.65066 WP_003113693.1.65092 WP_003113693.1.65099 WP_003113693.1.65196 WP_003113693.1.65197 WP_003113693.1.65237 WP_003113693.1.65247 WP_003113693.1.65285 WP_003113693.1.65335 WP_003113693.1.65337 WP_003113693.1.65588 WP_003113693.1.65740 WP_003113693.1.65867 WP_003113693.1.6589 WP_003113693.1.66062 WP_003113693.1.66277 WP_003113693.1.6629 WP_003113693.1.66345 WP_003113693.1.66348 WP_003113693.1.66371 WP_003113693.1.66526 WP_003113693.1.66892 WP_003113693.1.66931 WP_003113693.1.66945 WP_003113693.1.67010 WP_003113693.1.67188 WP_003113693.1.6734 WP_003113693.1.67388 WP_003113693.1.67686 WP_003113693.1.67755 WP_003113693.1.67903 WP_003113693.1.67948 WP_003113693.1.68000 WP_003113693.1.6808 WP_003113693.1.68162 WP_003113693.1.6850 WP_003113693.1.68541 WP_003113693.1.68561 WP_003113693.1.68781 WP_003113693.1.68800 WP_003113693.1.68857 WP_003113693.1.68862 WP_003113693.1.68910 WP_003113693.1.6931 WP_003113693.1.6937 WP_003113693.1.69534 WP_003113693.1.69556 WP_003113693.1.69788 WP_003113693.1.69791 WP_003113693.1.69834 WP_003113693.1.70092 WP_003113693.1.70098 WP_003113693.1.70194 WP_003113693.1.70216 WP_003113693.1.70229 WP_003113693.1.70460 WP_003113693.1.70470 WP_003113693.1.70561 WP_003113693.1.70670 WP_003113693.1.70831 WP_003113693.1.71385 WP_003113693.1.71570 WP_003113693.1.71642 WP_003113693.1.71666 WP_003113693.1.71822 WP_003113693.1.71891 WP_003113693.1.71934 WP_003113693.1.72149 WP_003113693.1.72181 WP_003113693.1.72331 WP_003113693.1.72346 WP_003113693.1.72378 WP_003113693.1.72447 WP_003113693.1.72458 WP_003113693.1.72562 WP_003113693.1.72570 WP_003113693.1.72653 WP_003113693.1.72669 WP_003113693.1.7276 WP_003113693.1.7308 WP_003113693.1.73135 WP_003113693.1.73149 WP_003113693.1.73172 WP_003113693.1.7329 WP_003113693.1.733 WP_003113693.1.73455 WP_003113693.1.73490 WP_003113693.1.73523 WP_003113693.1.73651 WP_003113693.1.73728 WP_003113693.1.73791 WP_003113693.1.73889 WP_003113693.1.74 WP_003113693.1.74000 WP_003113693.1.74072 WP_003113693.1.74074 WP_003113693.1.7408 WP_003113693.1.74180 WP_003113693.1.74182 WP_003113693.1.74264 WP_003113693.1.74268 WP_003113693.1.7445 WP_003113693.1.7456 WP_003113693.1.74772 WP_003113693.1.74776 WP_003113693.1.74948 WP_003113693.1.74958 WP_003113693.1.75041 WP_003113693.1.75119 WP_003113693.1.75204 WP_003113693.1.75303 WP_003113693.1.7547 WP_003113693.1.75599 WP_003113693.1.75631 WP_003113693.1.75792 WP_003113693.1.75826 WP_003113693.1.75860 WP_003113693.1.75938 WP_003113693.1.75947 WP_003113693.1.76092 WP_003113693.1.76192 WP_003113693.1.76322 WP_003113693.1.76383 WP_003113693.1.7666 WP_003113693.1.76791 WP_003113693.1.76922 WP_003113693.1.77238 WP_003113693.1.77286 WP_003113693.1.77490 WP_003113693.1.77566 WP_003113693.1.77574 WP_003113693.1.77587 WP_003113693.1.77686 WP_003113693.1.7779 WP_003113693.1.77819 WP_003113693.1.77834 WP_003113693.1.78134 WP_003113693.1.78158 WP_003113693.1.78380 WP_003113693.1.78409 WP_003113693.1.78430 WP_003113693.1.78437 WP_003113693.1.78669 WP_003113693.1.78693 WP_003113693.1.78810 WP_003113693.1.78926 WP_003113693.1.79007 WP_003113693.1.79177 WP_003113693.1.79193 WP_003113693.1.79256 WP_003113693.1.79279 WP_003113693.1.79357 WP_003113693.1.79364 WP_003113693.1.79429 WP_003113693.1.7945 WP_003113693.1.79463 WP_003113693.1.79507 WP_003113693.1.79544 WP_003113693.1.79601 WP_003113693.1.79631 WP_003113693.1.79908 WP_003113693.1.80087 WP_003113693.1.8028 WP_003113693.1.80306 WP_003113693.1.80411 WP_003113693.1.80481 WP_003113693.1.8051 WP_003113693.1.80535 WP_003113693.1.80627 WP_003113693.1.80632 WP_003113693.1.80644 WP_003113693.1.80645 WP_003113693.1.80720 WP_003113693.1.80846 WP_003113693.1.80880 WP_003113693.1.80892 WP_003113693.1.80929 WP_003113693.1.80931 WP_003113693.1.80938 WP_003113693.1.81081 WP_003113693.1.81082 WP_003113693.1.8110 WP_003113693.1.81206 WP_003113693.1.81331 WP_003113693.1.81482 WP_003113693.1.81487 WP_003113693.1.81643 WP_003113693.1.81742 WP_003113693.1.81748 WP_003113693.1.81771 WP_003113693.1.81802 WP_003113693.1.81816 WP_003113693.1.81957 WP_003113693.1.81960 WP_003113693.1.81986 WP_003113693.1.82127 WP_003113693.1.82178 WP_003113693.1.82260 WP_003113693.1.8227 WP_003113693.1.82312 WP_003113693.1.82334 WP_003113693.1.82442 WP_003113693.1.82580 WP_003113693.1.82606 WP_003113693.1.82620 WP_003113693.1.82710 WP_003113693.1.8284 WP_003113693.1.82864 WP_003113693.1.82887 WP_003113693.1.82936 WP_003113693.1.83025 WP_003113693.1.83131 WP_003113693.1.83463 WP_003113693.1.8353 WP_003113693.1.83637 WP_003113693.1.83698 WP_003113693.1.83715 WP_003113693.1.83946 WP_003113693.1.84162 WP_003113693.1.84174 WP_003113693.1.84177 WP_003113693.1.84178 WP_003113693.1.84271 WP_003113693.1.8437 WP_003113693.1.84374 WP_003113693.1.84404 WP_003113693.1.84538 WP_003113693.1.84589 WP_003113693.1.84715 WP_003113693.1.84754 WP_003113693.1.84792 WP_003113693.1.84937 WP_003113693.1.8498 WP_003113693.1.85018 WP_003113693.1.85220 WP_003113693.1.85290 WP_003113693.1.85298 WP_003113693.1.85303 WP_003113693.1.85357 WP_003113693.1.85446 WP_003113693.1.85574 WP_003113693.1.85788 WP_003113693.1.85910 WP_003113693.1.86002 WP_003113693.1.86047 WP_003113693.1.86055 WP_003113693.1.86058 WP_003113693.1.86125 WP_003113693.1.86287 WP_003113693.1.86293 WP_003113693.1.865 WP_003113693.1.86545 WP_003113693.1.86708 WP_003113693.1.86733 WP_003113693.1.86774 WP_003113693.1.86780 WP_003113693.1.86785 WP_003113693.1.86813 WP_003113693.1.87163 WP_003113693.1.87182 WP_003113693.1.87183 WP_003113693.1.8727 WP_003113693.1.87390 WP_003113693.1.87435 WP_003113693.1.87547 WP_003113693.1.87648 WP_003113693.1.87970 WP_003113693.1.87987 WP_003113693.1.88004 WP_003113693.1.88330 WP_003113693.1.88360 WP_003113693.1.88388 WP_003113693.1.8852 WP_003113693.1.88578 WP_003113693.1.88659 WP_003113693.1.88680 WP_003113693.1.88900 WP_003113693.1.88949 WP_003113693.1.88969 WP_003113693.1.89083 WP_003113693.1.8911 WP_003113693.1.89234 WP_003113693.1.89266 WP_003113693.1.89276 WP_003113693.1.89409 WP_003113693.1.89434 WP_003113693.1.89440 WP_003113693.1.8949 WP_003113693.1.89491 WP_003113693.1.89610 WP_003113693.1.89638 WP_003113693.1.8976 WP_003113693.1.89867 WP_003113693.1.89868 WP_003113693.1.89886 WP_003113693.1.90024 WP_003113693.1.90032 WP_003113693.1.90056 WP_003113693.1.90110 WP_003113693.1.90141 WP_003113693.1.90150 WP_003113693.1.90189 WP_003113693.1.90225 WP_003113693.1.90268 WP_003113693.1.9056 WP_003113693.1.90655 WP_003113693.1.90770 WP_003113693.1.90999 WP_003113693.1.91093 WP_003113693.1.91161 WP_003113693.1.91204 WP_003113693.1.91336 WP_003113693.1.91360 WP_003113693.1.91431 WP_003113693.1.91438 WP_003113693.1.91803 WP_003113693.1.9182 WP_003113693.1.91838 WP_003113693.1.91846 WP_003113693.1.92175 WP_003113693.1.92314 WP_003113693.1.92454 WP_003113693.1.92585 WP_003113693.1.92624 WP_003113693.1.92642 WP_003113693.1.9272 WP_003113693.1.92769 WP_003113693.1.92847 WP_003113693.1.92924 WP_003113693.1.92930 WP_003113693.1.93001 WP_003113693.1.93090 WP_003113693.1.93122 WP_003113693.1.93250 WP_003113693.1.93446 WP_003113693.1.93493 WP_003113693.1.93547 WP_003113693.1.93562 WP_003113693.1.93797 WP_003113693.1.93848 WP_003113693.1.93897 WP_003113693.1.94136 WP_003113693.1.94174 WP_003113693.1.94211 WP_003113693.1.94243 WP_003113693.1.94285 WP_003113693.1.9444 WP_003113693.1.94818 WP_003113693.1.94874 WP_003113693.1.94896 WP_003113693.1.95025 WP_003113693.1.95056 WP_003113693.1.95132 WP_003113693.1.95207 WP_003113693.1.95217 WP_003113693.1.95305 WP_003113693.1.95324 WP_003113693.1.95359 WP_003113693.1.95460 WP_003113693.1.95488 WP_003113693.1.95536 WP_003113693.1.95638 WP_003113693.1.95668 WP_003113693.1.95745 WP_003113693.1.95751 WP_003113693.1.95774 WP_003113693.1.95787 WP_003113693.1.95999 WP_003113693.1.96008 WP_003113693.1.9604 WP_003113693.1.96041 WP_003113693.1.96134 WP_003113693.1.96193 WP_003113693.1.96357 WP_003113693.1.96384 WP_003113693.1.96434 WP_003113693.1.96452 WP_003113693.1.96667 WP_003113693.1.96702 WP_003113693.1.96714 WP_003113693.1.96880 WP_003113693.1.96967 WP_003113693.1.9722 WP_003113693.1.97271 WP_003113693.1.97272 WP_003113693.1.977 WP_003113693.1.97826 WP_003113693.1.98276 WP_003113693.1.98308 WP_003113693.1.98433 WP_003113693.1.98515 WP_003113693.1.98522 WP_003113693.1.98573 WP_003113693.1.98600 WP_003113693.1.98672 WP_003113693.1.98693 WP_003113693.1.98788 WP_003113693.1.98814 WP_003113693.1.9885 WP_003113693.1.98958 WP_003113693.1.98960 WP_003113693.1.99103 WP_003113693.1.99214 WP_003113693.1.99386 WP_003113693.1.99389 WP_003113693.1.99461 WP_003113693.1.9951 WP_003113693.1.99516 WP_003113693.1.99654 WP_003113693.1.99662 WP_003113693.1.99746 WP_003113693.1.99757 WP_003113693.1.9989 gi|15597397|ref|NP_250891.1| 2fef_A 2fef_B 2fef_C gi|558678095|ref|YP_008814803.1| APC5629 gi|558671557|ref|YP_008808267.1| gi|568309912|ref|YP_008982181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]