SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386833743|ref|YP_006239057.1| from Pasteurella multocida subsp. multocida str. 3480

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386833743|ref|YP_006239057.1|
Domain Number 1 Region: 323-478,752-857
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000592
Family ABC transporter ATPase domain-like 0.057
Further Details:      
 
Domain Number 2 Region: 6-147
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000628
Family PHP domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|386833743|ref|YP_006239057.1|
Domain Number - Region: 337-413,514-536,632-730
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00106
Family Nucleotide and nucleoside kinases 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386833743|ref|YP_006239057.1|
Sequence length 917
Comment ATPase [Pasteurella multocida subsp. multocida str. 3480]
Sequence
MLRGSEWGRWDLHVHTKNTAKNDQFKSRDMNEYCEILFKKAIKKDIKVIGITDYLNIDNY
KKVLDFKENIYTNNKFTDDEKDKVSDIFIIPNIELRLDKIARKSLINIHILFNPAFIEEV
ENSLLTKIEFPISTDLSASLNRHGLIKLGKHRDPRLNDEEAYLEGIKHFCVDYNRLIKII
NENKLLKENCLVFVANGDNDGVSGLKTHEELLGSTSSNSELRDSIYRQADGIFSSQISDR
NYFLGNGKDSSGKIIDRLGFLKPCIHGSDAHTENKLFEPDQQRYCWIKADPTFEGLKQIL
YEPESRVHIGATVPEFKNDYEVIDHIKLDNNDVFNKEIYFNQNLTTIIGGRSSGKSTLLQ
CLAKKLNKPLAENKESENRFSHIKDLSSNLQIIWKDGREDDSRRVEYFYQGHMYQKSTNK
GIEDIIKEVLLQQKPDIFDKYDEAISNIKISNTTNLTEYSNAKEKIKALNQSLEKLGNYN
DVLSQLDKLNEKINKLNLSELNEHELEYYHNKNNVLVENNEKSEKIISILSKLDNLNIDD
VFSFHIKQDIPSYKDIPWDLSDEICDIRKYIENEINKSQKEYRKKLESEIDRLSLLNREI
ENDALFNRVKALLEKSLQATPILTQIEKEKTKKINIENINAEIASFQRLIDEKYDNIEKT
WRLMFDELDNLIDSINNISLNKGQLIISSSQEFQVISFRGFIDQRSGLAQSLVSEIPLIK
TKEELYQFFNKIKDGLINQSIKLRNSFSLEGFITEFFSDSWFKLKYDVIYDGDSYNNMSQ
GKKAFVVLKLNLECSDSKCPIIIDQPEDDLDNRAIYSELVSYLKTKKSERQIILVTHNPN
VVINADSELVIVANQHGSKSFNTNGKKFEYISGSIESIKAEKESTLTLAKNTIREHICEI
LEGGEQAFKLRERKYSF
Download sequence
Identical sequences WP_014667814.1.27592 WP_014667814.1.41657 WP_014667814.1.42512 WP_014667814.1.94432 gi|386833743|ref|YP_006239057.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]