SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312622820|ref|YP_004024433.1| from Caldicellulosiruptor kronotskyensis 2002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312622820|ref|YP_004024433.1|
Domain Number 1 Region: 32-149
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000131
Family Collagen-binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312622820|ref|YP_004024433.1|
Sequence length 355
Comment peptidase domain-containing protein [Caldicellulosiruptor kronotskyensis 2002]
Sequence
MKRVLKCFSKFLMFLIVFTLTIWYNEIAKAGEVYEQENNNSFSTANTINFGDFVKGLIYQ
STNPSQDKDYFKIYFRAGDIVAISFINAHELVDYNIYLYNSSQNLVASSTNPKGKNEFIQ
YTVPSSGNYYILVSSAYGHSGSHYYSLQLMRSSYNSGNTNTSYNRTAAKNYAIDNATYKN
SYTCRGITFANFANYGGDCTNFASQVLFAGYMDMIYSTSSGIEGNVNYWFYRTSTNRTTT
WTGANYFRQHWGNLDGAGRNRAYQMRIYPVWYALERYSSVVLGFLKEGDIVQHVRYDNCE
AYHSQVIVSKTATDLLYAQHSTTPEYFYSGRSFREYLNKDTLPMNWVILYRISSN
Download sequence
Identical sequences E4SFT9
gi|312622820|ref|YP_004024433.1| WP_013430702.1.20482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]