SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|312115471|ref|YP_004013067.1| from Rhodomicrobium vannielii ATCC 17100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312115471|ref|YP_004013067.1|
Domain Number 1 Region: 349-405
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000724
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|312115471|ref|YP_004013067.1|
Sequence length 407
Comment proteinase inhibitor I2 Kunitz metazoa [Rhodomicrobium vannielii ATCC 17100]
Sequence
MLRLCKSLRLLGAILPAVFLIPLPALADMGRVMVSNQGVTVEESAQKAIILANGREEVLI
LGTEIGASGKTSILRFIPFPAEPKAELAAPGAFQQLASLAKKYDLRFQSRWQTKGGSSSK
DEGVKVVSSARLGAHDLTTVRIRDVAAFRSWVNDYFKSHDLPLADAYPTEEAIVADYVAR
GLTYFVLDYVALEKETRFIEPVAYRFASAELYYPLVTSNSFGGKGAIELFVVAPVTLCRP
GSNDGMGYFRGDDHDLAVTIPGQPDRKCLDLPVKASTSARLPVEERDLDAIYSGWAELFA
DTPMFLQAFRYTGDYHFAADILVPVIGEGNALKAEEDGRNPFAPLRDLALPEACHLKPEG
GRCKANFEAYYFDPAAGACKWFSYGGCGGVVPFETLDACEKSCLPKN
Download sequence
Identical sequences E3I842
gi|312115471|ref|YP_004013067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]