SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317123937|ref|YP_004098049.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317123937|ref|YP_004098049.1|
Domain Number 1 Region: 336-508
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000000000353
Family Lambda integrase-like, catalytic core 0.037
Further Details:      
 
Weak hits

Sequence:  gi|317123937|ref|YP_004098049.1|
Domain Number - Region: 7-142
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0264
Family Cytochrome c3-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317123937|ref|YP_004098049.1|
Sequence length 591
Comment hypothetical protein Intca_0785 [Intrasporangium calvum DSM 43043]
Sequence
MTAPPMCQGCSRRPEAYRKRGWCYDCKPGSKGRPLPCRRCGRDGDYWSSGLCRLCHPLAP
QAPDSCRDCLAWGVTRLRGRLCLACTAWRYAHPGAGECICCHRELAVNQHQACRLCWAQT
FTRQAQLGLPRDVLSANQAGQQLWFANMTNPRNGYRPHPRRDYRRPRDQRHPVEEDPTAG
EPAAPTAPGPGQLDLFAYHPIEDPARRYGFGDPPSSRFAALLDQLTLEHAARYGWTTRQT
KETRITLRVLQARSRLYGPPVRATDVQQLIEDGLRVRLPMAVLTEADLLFDDRPPRLVTW
FTRQLHGLPEAMASELQTWFEVLHHGSTVPPRSHPRSEGTIRTRTLWAMPTLRAWAADGH
HSLREITRSDILAVLPGEGTPRATLGAALRSIFTTLKGHRLLFVNPTARIRVGTLERRTP
MPIATAAIRAAFDSDDPATAAITTLIGIHGLRPREACALHLFEVRDNRITLPDRSILLAP
ATKARLDRYLAYRRERWPGCINPHFLIHARSAATPEQVRVPWLTDKLGMSADALRQDRIL
AEANAGSDLRRICDFFGVTIETAEHYARTVSHPDLDAFTTDPAGSRTDTPQ
Download sequence
Identical sequences E6SB61
gi|317123937|ref|YP_004098049.1| WP_013491642.1.66196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]