SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317124615|ref|YP_004098727.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|317124615|ref|YP_004098727.1|
Domain Number - Region: 79-159
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0314
Family Cgl1923-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317124615|ref|YP_004098727.1|
Sequence length 164
Comment hypothetical protein Intca_1485 [Intrasporangium calvum DSM 43043]
Sequence
MLPSMTTGEPTEQTAPRRGRQAFQSLPGDWARRPMTDPDLFEGVVDLAVLEAFRAVGGLA
LLLCHGDGRLMQPLTLESVNAASPPARAESILREVLLDVARGGAPAVVIVIARPGSATPT
EHDLALRQAFVGACGASGLALLGVAVAVPGSVSTLPCPSETEAA
Download sequence
Identical sequences E6S7U3
gi|317124615|ref|YP_004098727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]