SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317124627|ref|YP_004098739.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317124627|ref|YP_004098739.1|
Domain Number 1 Region: 20-272
Classification Level Classification E-value
Superfamily Cgl1923-like 1.96e-72
Family Cgl1923-like 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317124627|ref|YP_004098739.1|
Sequence length 312
Comment hypothetical protein Intca_1497 [Intrasporangium calvum DSM 43043]
Sequence
MQDPTELFQFETDSSLSPDDTHASVLVLALGGFVDAGHTQRVLTEHLLENHESRVIASFD
VDQLLDYRGRRPAMVFDRDHWESYADPSLLLHRVVDREGVPFLLLAGPEPDYQWARMVEA
VMILIRALDVDLTVNVHGIPMAVPHTRPLGFTSHGTNQNLLLSGNETPFGTVQVPGSFAS
LLELRLGEAGRDALGFAVHVPHYLGQSEFADAALLGLQRVIAVTGLDLDATGLAAAAGRD
RAEIARQMEQSEEISAVVRALEQQYDTYLEGRQHRSLLATDLSDLPTADEIGAEFEAFLK
DVADDAGDGPSA
Download sequence
Identical sequences E6S891
WP_013492328.1.66196 gi|317124627|ref|YP_004098739.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]