SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317124997|ref|YP_004099109.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317124997|ref|YP_004099109.1|
Domain Number 1 Region: 97-148,176-211,296-324,410-445,493-560
Classification Level Classification E-value
Superfamily Multiheme cytochromes 5.53e-20
Family Cytochrome c3-like 0.043
Further Details:      
 
Weak hits

Sequence:  gi|317124997|ref|YP_004099109.1|
Domain Number - Region: 182-248
Classification Level Classification E-value
Superfamily MCP/YpsA-like 0.0412
Family MoCo carrier protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317124997|ref|YP_004099109.1|
Sequence length 569
Comment NapC/NirT cytochrome C domain-containing protein [Intrasporangium calvum DSM 43043]
Sequence
MTPSSDGPQQAGPPRPPDPVVPPGGPTPGGPTPRAEAADAGSAETGSAPSEGFWARWRRR
LRRLVPVPKTPLGVLALVGGVLVIGAIGTLGGVEVVHYSEGASFCTTCHTMEPQKKAYEA
GVHQDVACGECHVEPGVLGFVKAKLAGTRELYALVTNTYPTPIPAIEHDALPTTEQTCEK
CHPLSQIAKDGQPTKLITRASFSRDEKNTRNDLAVLIRPAQAGTADEVSMHWHVLQEVTY
TSTEEHQQTIDSVEFRDSKTGELVQYIAEGAVRQSANADADIARLKATGSTRTMDCLACH
NRVGHDIPSVDKAVDQAMASGAISPTLPYIKRNAITLLNRTYATDEDGEAAIGNLAELYS
ADYPAVAKDKAKEIAAASKAIAGIYELVVTSEMNTRGGTYADNLGHQSSPGCFRCHDGAH
YKVVEGQVTKETIPSTCNTCHTFPQGVSTPASVPIGKGSTEPVSVPIGKEPADHADPLFV
FSHRNVAGAVKPAASSCGACHEASYCQDCHDSGAVKVDHYGMLYNHAQSVLDAGSKNACA
VCHQPAYCSQCHKDPVLVQSNAKLSKGSG
Download sequence
Identical sequences E6SB94
WP_013492697.1.66196 gi|317124997|ref|YP_004099109.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]