SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317125003|ref|YP_004099115.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317125003|ref|YP_004099115.1|
Domain Number 1 Region: 378-417,451-485,523-552,604-673
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000000000336
Family Di-heme elbow motif 0.033
Further Details:      
 
Weak hits

Sequence:  gi|317125003|ref|YP_004099115.1|
Domain Number - Region: 598-736,769-780
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000516
Family Cytochrome c3-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317125003|ref|YP_004099115.1|
Sequence length 789
Comment cytochrome C family protein [Intrasporangium calvum DSM 43043]
Sequence
MTRNRTTPPRHTRLGGWPAAVAMVPLLALALTATPAVGLAAEDLPTPTATTTSSPSPTPT
PTSSATETPTAPPTAEPSPTTSGTTPGTEAAATTAPATDPSTEPSATSSTDLTAASTDLL
SLPVPGLSGGAAALALLGDPGVTPRYLPAGAPAAGLGPFQSVRLVAPLLNGGPDPVTVTP
QLEFRVAGTGDFQVVPEAATPGVPLHSAEEWVATETGSAPAPRSTPIPADSLHVTIPDGL
TAVAGQRSSGINPVTPYFLPPGTATEQEFTVTLSIDAGYGTSYELRVTDDGSAIPLLEPA
TVTVGAAPATLASPGQQDGEQVSGLPEAQATAYALVGAPEADATKTSYPLYTALAGPDVA
TDAVITVGPNGPGTIHNPGASTTSGQCGVCHQTHSAKSQNLVKKSSETDQCYTCHAGGTG
GADVQAQYALGQPANDPTTRSYWSHDTTDPGDHTLDSKNEFAGALSRHSQCSDCHDPHGA
TTSKSTMTATGWTAPGGFTKVGGVAVTNGAAGTAPTYTWLDGMVQPVTAEYQLCLKCHSG
FTTLPEDVAGKPSQSFTDLAVDFNPANGSYHPIEAPGRNQTQKLADSLAGPSPYKLWNFT
TNDTVRCVSCHASNTTGTSADPAENGPDATLTVHASTNRGILIRPYENRVLSKAGQYYDA
KGFALCLACHMETPYLNRVRPAAAEGTNFVFHGLHVSGITTKGSGGLDIDTPGAGQGNAR
CAECHFSSHGTTQLPDGQQVAGDRLIGFPPNVLPSKAMGGVPTFKKTATGGTCTLTCHGK
DHQGATYSN
Download sequence
Identical sequences E6SBA0
WP_013492703.1.66196 gi|317125003|ref|YP_004099115.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]