SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317125004|ref|YP_004099116.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317125004|ref|YP_004099116.1|
Domain Number 1 Region: 31-122,213-221,305-397
Classification Level Classification E-value
Superfamily Multiheme cytochromes 4.86e-20
Family Cytochrome c3-like 0.087
Further Details:      
 
Weak hits

Sequence:  gi|317125004|ref|YP_004099116.1|
Domain Number - Region: 169-356
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00897
Family Cytochrome c3-like 0.095
Further Details:      
 
Domain Number - Region: 8-74
Classification Level Classification E-value
Superfamily Cytochrome c 0.0849
Family monodomain cytochrome c 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317125004|ref|YP_004099116.1|
Sequence length 399
Comment cytochrome C family protein [Intrasporangium calvum DSM 43043]
Sequence
MRTDRKVMRRVVLVAAASAALFMGATPAQADNGPHVSTATNNTTFVDGQPTNGVKISDAG
QGRCASCHRAHTAKAPYLLNATSEEALCFSCHGTGGTGATTDVQGGVGYDTASSTTYPDG
TTVQTVVRGSTQVLPLRGGGFEKAMLGSSEATKDMGVLGAHGWTSVNQLIPPAPTQEATT
SSHLGGVNVMWGNGALSATPNTGKVMSSPKLECTSCHDPHGNKQYRILRPVPSDSGFSAT
AFPDGILIPDTTNKVYTTDNYWSVGDTNVPAEELTTTILGATSIVDPTPKIKTSSVAVSP
YMANVAAWCTTCHTRYLAPSQSYKTDSGDAVFTYRHTGDNVSGDRDARSRNCIQCHVAHG
SNAVMPNSSVEWPDGTTPSSDSRLLRVDDRGICVMCHNV
Download sequence
Identical sequences E6SBA1
gi|317125004|ref|YP_004099116.1| WP_013492704.1.66196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]