SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317126174|ref|YP_004100286.1| from Intrasporangium calvum DSM 43043

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317126174|ref|YP_004100286.1|
Domain Number 1 Region: 35-204
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.23e-25
Family Astacin 0.059
Further Details:      
 
Domain Number 2 Region: 238-338
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000314
Family Collagen-binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317126174|ref|YP_004100286.1|
Sequence length 341
Comment peptidase M12A astacin [Intrasporangium calvum DSM 43043]
Sequence
MTDKVCFDRILPQDLMRPHRRTRDLEGRDRAISPIGKSWMNGTTLRVRFLGGTPDQQAVA
RDQAGWWAQACNLHFDFGNHPQSASDLRISFDQNDGAWSYVGTDCKGIPSNQPTMNLGFL
DGGTAAHEFGHAIGLAHEHSNPAGGIQWNEPVVLAALAGPPNFWDEATVRHNVFRKYALD
QIKGTAFDPESIMLYAFPASWTLNGMGTHSNEVLSGLDREFVAGSTMYPKPGPVVGDAVT
LPLDGTKVNADIGKGGEEDLFTFVVESDGVYEVRTSGSTDVYLKIFGPDQDTALVAEDDD
SGYGLNARIRRALVPGRYWAQVRHWNVESGTGKYSISVRPR
Download sequence
Identical sequences E6SC19
gi|317126174|ref|YP_004100286.1| WP_013493871.1.66196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]