SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313681018|ref|YP_004058757.1| from Oceanithermus profundus DSM 14977

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313681018|ref|YP_004058757.1|
Domain Number 1 Region: 114-538
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.49e-105
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000251
Further Details:      
 
Domain Number 2 Region: 1-127
Classification Level Classification E-value
Superfamily Cytochrome c 8.92e-25
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313681018|ref|YP_004058757.1|
Sequence length 539
Comment dissimilatory nitrite reductase (no-forming), cytochrome cd1 type apoprotein [Oceanithermus profundus DSM 14977]
Sequence
MRWSKALTVGLAALALGALAVAQGLTPEQMEEGKKIYFQQCAGCHGVLRKGATGKNLEPD
KLKAAGKNVDYLKAIITNGFGGMPAWGKLGILTPEQIDLMAKFLLSPVPEPPPWTFEDIK
NNWVVYVPVSKRPTQPETTRNWQNFFGVILRDMGQVAIVDGDTKELVKILPTGYATHILR
SSKDGRYFYVIGRDGKAEIIDLWSKEPTLVAEAKVCLDARSIDTSKYEGYEGKYAVVGCY
WPSNFVILDGQTLEPLKMVSTQGYVKSTGEFLRENRVASIVSSHFSPEWILNIKEGGQTW
LVDYANIGLKGKPINVRMIDTERFLHDGGWAMDKRYFLVAANAAKKIVVIDAKTGEFVAS
IPVGDKPHPGRGANWVHPKYGPVWATGHIKDNKIAVIGTDPKGHPDYAWKVVKMIETPYP
GNLFIKTHPKSPWLIVDFTVAPTPEANATLCAWKKEDLEKDPICWEVPGAKKLKARMVHI
EFNKDGSEFWVSAWGNKDTPTFIVVYDSVTLQEKTRITGDWVRTPTGKFNVWNTANDIY
Download sequence
Identical sequences E4U5B0
gi|313681018|ref|YP_004058757.1| WP_013458754.1.73382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]