SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317054769|ref|YP_004103236.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317054769|ref|YP_004103236.1|
Domain Number 1 Region: 126-273
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.09e-61
Family C-terminal domain of ribosomal protein L2 0.00000222
Further Details:      
 
Domain Number 2 Region: 2-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-51
Family Cold shock DNA-binding domain-like 0.00000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317054769|ref|YP_004103236.1|
Sequence length 277
Comment 50S ribosomal protein L2 [Ruminococcus albus 7]
Sequence
MAIKTYKPTTPGRRGMTVIDYSGLSKVEPCKSLLEPLKKNSGRNSYGRITVRHRGGGVRR
KYRVIDFKRNKLDMNATVQTIEYDPNRSAFIALVQYEDGEKRYIIAPNGLAVGDVIRAGA
GADIKPGNALTLADIPVGTFIHNIELYPGKGAQLVRSAGNMAQLMGREGAYALVRLPSGE
MRKISVNCMATIGQVGNIDHSNVNIGKAGRKRHMGWRPTVRGSVMNPCDHPHGGGEGKSP
VGRPSPVTPWGKPTLGYKTRAKHARSDKFIVKRRNGK
Download sequence
Identical sequences E6UB61
WP_013496803.1.49193 WP_013496803.1.63498 gi|317054769|ref|YP_004103236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]