SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317054795|ref|YP_004103262.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317054795|ref|YP_004103262.1|
Domain Number 1 Region: 51-174
Classification Level Classification E-value
Superfamily Insert subdomain of RNA polymerase alpha subunit 7.59e-41
Family Insert subdomain of RNA polymerase alpha subunit 0.000043
Further Details:      
 
Domain Number 2 Region: 9-51,175-229
Classification Level Classification E-value
Superfamily RBP11-like subunits of RNA polymerase 8.77e-32
Family RNA polymerase alpha subunit dimerisation domain 0.00067
Further Details:      
 
Domain Number 3 Region: 250-316
Classification Level Classification E-value
Superfamily C-terminal domain of RNA polymerase alpha subunit 6.54e-24
Family C-terminal domain of RNA polymerase alpha subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317054795|ref|YP_004103262.1|
Sequence length 319
Comment DNA-directed RNA polymerase subunit alpha [Ruminococcus albus 7]
Sequence
MLEKIEKPKIETPELKSNGTYGKFILEPLERGYGITLGNSLRRVLLSSLPGVAVTSVKID
GVHHELSTIPGVKEDVTEIILNLKGLTAKLYGEGPKTIYIEAEGECVVTAGDIKADSEVD
ILVPDMHIATLGAGAKLYMEITIDRGRGYVSAEKNKSLMQNAPIGIIAVDSIYSPVLKVN
YTVDNTRVGHITDFDKLTLEVWTDGTISAKEAVSMAAKLLNEHLNPFVDLSEETNVVELI
VEKDDQGKEKILEMTIEELDLSVRSFNCLKRAGINTVNDLIEKSAEEMMKVRNLGKKSFD
EVREKLHSLGYELNSEEDN
Download sequence
Identical sequences A0A1H7GGU9 E6UBN6
WP_013496822.1.49193 WP_013496822.1.63498 WP_013496822.1.72734 WP_013496822.1.84483 gi|317054795|ref|YP_004103262.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]