SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317054908|ref|YP_004103375.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317054908|ref|YP_004103375.1|
Domain Number 1 Region: 409-468
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000746
Family Type I dockerin domain 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|317054908|ref|YP_004103375.1|
Domain Number - Region: 68-184,289-423
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00366
Family Galacturonase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317054908|ref|YP_004103375.1|
Sequence length 473
Comment hypothetical protein Rumal_0184 [Ruminococcus albus 7]
Sequence
MKDLIKRIVSASAVLFVSAAVLSGFPAGTLKASAGEVYDIYVGKERVETSNCKDILGNGV
FSYEPETSTLTINGNYGYESAELISSNIEDLTVNVIGDSELKGYFYFYKDTTITGTGKLS
LSTSDSLNAITLYGGTRLTIMDADLDISGCNAISGSIRGTQDIYISGSYINAHGKEAAIC
DLNTVSIFRCDITKPAYCFWGEGGIYEADMTTYAKDVRMIPSYDLWIDENKVNADNCHDI
LDNGIFSYDPVQKMLTISGSFDHPMDQELIYSSEKGLIINVTEDSEIPGYTVLHEDTVIT
GKGVFITGTGTSSGNSITAIANHNCKLTIDNTRLMALGHVGIGTTTGSIDIYNSDVLAAG
SEQAFAFAPDSFNIYDGNLSFPSPYTVGNNTIYDGGSKAAKMVAIERLKVKGDINGDGII
NVTDLSLAAAYVKGKRSLNEDQESRADISGDGKITITDISIIAAHIKGKKAIV
Download sequence
Identical sequences E6UCE9
WP_013496933.1.49193 WP_013496933.1.63498 gi|317054908|ref|YP_004103375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]