SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055001|ref|YP_004103468.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055001|ref|YP_004103468.1|
Domain Number 1 Region: 15-186
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 1.7e-22
Family Archaeal IMP cyclohydrolase PurO 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317055001|ref|YP_004103468.1|
Sequence length 238
Comment Inosine monophosphate cyclohydrolase-like protein [Ruminococcus albus 7]
Sequence
MKTLDIYEELKGNAYPGRGIVIGKSADGKNAVTAYFIMGRSVNSRNRVFTETADGIKTEA
ADPSKLSDPHLIIYSPVRVLGNKTIVTNGDQTDTIYELMDKQQTFEQSLRTREYEDDAPN
YTPRISGIMHVGDGQYNYAMSILKSADGNPDSVERFTFSYSTPIAGYGHFIHTYMGDGNP
LPSFEGEPKKITIPNDIDEFTNGLWNALNEDNKVSLFVRFIDIETGKAVSKIVNKYTK
Download sequence
Identical sequences E6UD40
gi|317055001|ref|YP_004103468.1| WP_013497026.1.49193 WP_013497026.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]