SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055030|ref|YP_004103497.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055030|ref|YP_004103497.1|
Domain Number 1 Region: 196-393
Classification Level Classification E-value
Superfamily L domain-like 1.36e-21
Family Ngr ectodomain-like 0.019
Further Details:      
 
Domain Number 2 Region: 409-478,524-552,587-718,777-831
Classification Level Classification E-value
Superfamily L domain-like 7.23e-19
Family Ngr ectodomain-like 0.042
Further Details:      
 
Domain Number 3 Region: 1131-1190
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000693
Family Type I dockerin domain 0.0025
Further Details:      
 
Domain Number 4 Region: 1052-1122
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00000000129
Family Invasin/intimin cell-adhesion fragments 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317055030|ref|YP_004103497.1|
Sequence length 1195
Comment Ig domain-containing protein [Ruminococcus albus 7]
Sequence
MRKKILAGVAAVLMVASCVPANTNFGFSPIAPITASAAKAKLELDYVIISETSSGDIEIT
PKNIFDCLGVSDSVSTLNINFSKLKSTIVEYAGGSLSGKKVILKKPNTSLTADVNLAHIN
FTDDIITDVGASFASGCKTLQTVNFGSKINTIGSSAFSNCDHLQGTSGTKLDLSNIVNID
ASAFNGTVEIQSIKFGSNLKTIGRSAFSGNTALKTLDLPAALTKIDDNAFYNCKALESVF
FRGSNTISYIGISAFSNCTSLTAVSVNGSTSNTLPNGTADISCGTNLFSGCTSLQNFTWP
KSFTIIPDGTFNGCTALTNFAFEGGATGSACATIGKSTFNKCESLTSIELPNANTTILAS
AFNNCFKLENVVVSDKLTNVGEGAFGGCWVLTLYPRSDANKTKNKVVLPSTWQVISNSTF
SNCEGITQVDISPATYIGGNAFYSCNSLQSIKIPDAVTTLYDNTFCDCKSLKNVVVSKKL
AVLGKNEKSPSSTPSGCVFKDCISLETLTPSDATVLPYTIQFPASLGGVQKSSFENCPSI
KYINFAKNSQFSVLGERAFYKCKGLLGSNEGGNANNTILMPTGVRDIFSYAFAECNSLKN
IQFLGSVSTIGISAFQKCTALEDVIMNDTIQQVRDSAFADCSSLKSMPHTKEGKTAFSHI
DTINASTFKNCTSLTEAFIPKNVTVIGNSAFSGCKTLEKVLWEKGSALATIDTSAFNGDE
KLAVFTYQGGSANSTFPDSLTKINSHAFTKTALTKVTIGTPANGDKILLGSYTFSDNKSL
ISVDLSGSNIIEIPKYCFSNDTNLKTVLLPESSLTKLDDYAFSKCNRLHTFGSTSAKSGE
YTLPESLTSIGDKVFADNFCMQVINIPASATSLSMSMFNIDLRNAKVEENGYTPLEAIRV
HSNNPNYKSVDGILYSKDMTILYNRPINKKDPTYAVPSTVKTIKSYACVNSNLKNVVLNE
GLQYIEEKAFNDCHSLEGVDFGKNGSVIFPENKVIFAKDKGKITLYGTTGSTAEAYASKN
TSKVTFIDNDRAAAKLEIISKGGNVLTGGVQLAINDKTYTFGCKQTTASGKEAADNLIWS
SSDVEVAVIDNTGKVTFKSKGVTTIKVTNANGTAVASITLTVADKSTLNDYIPGDVTGDG
TVNVADISKIAAHIKGKKQINSTRFMSADVNGDGSVNVSDLSKIAAHVKGKKLLS
Download sequence
Identical sequences E6UDN5
WP_013497055.1.49193 WP_013497055.1.63498 gi|317055030|ref|YP_004103497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]