SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055051|ref|YP_004103518.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055051|ref|YP_004103518.1|
Domain Number 1 Region: 155-480
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.66e-54
Family beta-glycanases 0.00043
Further Details:      
 
Domain Number 2 Region: 493-550
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000981
Family Type I dockerin domain 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|317055051|ref|YP_004103518.1|
Domain Number - Region: 35-141
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00017
Family Family 6 carbohydrate binding module, CBM6 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317055051|ref|YP_004103518.1|
Sequence length 553
Comment mannan endo-1,4-beta-mannosidase [Ruminococcus albus 7]
Sequence
MDNIKARHKRVLAAVCAAVCVLASVPVSAEKAAARYEAEKAVLDKVDVQGDYVSLKSEGS
VTFKVEISETGWYDLDFISSGIGGSKENNASVDGEFTGRFKSESGAMNDSEIKNVFMEKG
SHDITVTPSWGWINIDALVINAAQLKNSYDVKGELSNKNATDSTKRLMAFLKDNYGMKTI
SGQQCDGGLNGTEFKVIKEATGKTPALVGLDLMDYTPSRVSLGAKGNSVEKAIEFSKAGG
IVEMCWHWSAPRKYIKEGKDSNGNPMWWGSFYTANVTIDFDAVMNGKDPEGYKLLMSDID
TIAAELKKLQDADVPILFRPLHEGSGGWFWWGSGSANSYKKLWVTMYDKLTNEHGLNNLI
WVYNGQSKDWYPGDEYVDIIGEDIYPGKQVTSPQSSKFLEAADYTDDTKIVTLSENGCLF
DPDVAHDRNTLWSWFCIWGGEFVRSGSKLSEEYSTAEMWKKVYNSEYVLTLDELPDLRSY
PVEGDVPPVDDLQTGDINHDGKVDVTDISLAAALVKGIKTPKDKTAADVNGDGKVNITDI
SLIAAHIKGIRNL
Download sequence
Identical sequences E6UDQ6
gi|317055051|ref|YP_004103518.1| WP_013497076.1.49193 WP_013497076.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]