SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055152|ref|YP_004103619.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055152|ref|YP_004103619.1|
Domain Number 1 Region: 128-185
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.74e-19
Family Cold shock DNA-binding domain-like 0.00083
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.83e-19
Family eIF5a N-terminal domain-like 0.0036
Further Details:      
 
Domain Number 3 Region: 65-129
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.44e-17
Family Cold shock DNA-binding domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317055152|ref|YP_004103619.1|
Sequence length 185
Comment translation elongation factor P [Ruminococcus albus 7]
Sequence
MVTAGDFRNGMTFEEEGNVMQIVEFQHVKPGKGAAFVRAKVKNVITGSVIEKTYNPTAKF
PTAYVERKDMEYSYSDGDLYYFMDSETFELIPVNKSELSDNFKFVKENMVCKILSYKGQV
FGVEPPFFVDLEVTETEPGEKGNTATNATKPATVETGAEIRVPLFINTGDRIRIDTRTCE
YMERA
Download sequence
Identical sequences E6UF99
gi|317055152|ref|YP_004103619.1| WP_013497177.1.49193 WP_013497177.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]