SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055207|ref|YP_004103674.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055207|ref|YP_004103674.1|
Domain Number 1 Region: 800-1010
Classification Level Classification E-value
Superfamily SGNH hydrolase 7.83e-41
Family Rhamnogalacturonan acetylesterase 0.017
Further Details:      
 
Domain Number 2 Region: 185-379
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.66e-32
Family YxiM C-terminal domain-like 0.00015
Further Details:      
 
Domain Number 3 Region: 41-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-30
Family YxiM N-terminal domain-like 0.0000347
Further Details:      
 
Domain Number 4 Region: 390-533
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.39e-25
Family Ricin B-like 0.003
Further Details:      
 
Domain Number 5 Region: 663-775
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000117
Family Family 6 carbohydrate binding module, CBM6 0.026
Further Details:      
 
Domain Number 6 Region: 558-622
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000131
Family Type I dockerin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317055207|ref|YP_004103674.1|
Sequence length 1020
Comment Ricin B lectin [Ruminococcus albus 7]
Sequence
MRFKKLVSGLTSAALSLLMLSGIGVPNANGVLTAKAATANWKFDFGTGGTASGYTGVSAS
DEYASWRGYGFAQTGNVGNVSAGGNGAGSDAVEFKSDSGSNTFNVDLPKGLYEVKVTVGN
APRCCIKMEGMFQMMNLTGLNASETVKLPVTDGQLNIQAVTGISNGQRSISAVEITQINT
TGVMPKTVWICGDSTVANYYNRSSTQAHGWGQYFGTYASQHGFEVRNMATSGQYAKGFYD
GGQFTPIETYGKSGDIYIISIGINDTNYSNKDEYHSTVSTMTQKAKAKGMDVILVKQQGR
HADYNRNPKLSGRWFGGELDSVASEENVRVVDLFNAWQDFGFSIGGYDAMTPYYASGDDL
HQSLEGAKKLAELMSGLVFETKEPVQMDTSKMYRFKNVNSGLYLEVKNGEAAVGANVQQW
SGAQVGDWNTWRLKHKGYNYYEIWSYLGGGSTYLLDVANGSSANGANIALNTNQNYGAQW
FRFFENGDGSYTMVSRCSGDKGAIEVGSALTYEGANIQQWEVNGHNCQKWILEEVQPNDP
EPEPEPEPEPEYTNTLTRYPGDANADGKVDMADAVTIKQYLNNSYRYPLCKQGMKNADVD
GNGSINDNDVLYIQQYALGMRSFPAPVYENVSVSTDPWDGYYFAVDQTWDDAWAEETNSG
FTKTSTDIGKSSNTGYINLNNAVGSSLTFKVTAPTSGKYMAYVRFSNGSSSSRDTKVFVN
GNTSSYWIQTFASTGAWTTWDALGLVLPLNAGDNTIKFESAGSDGGPNFDYLTITLTDEP
VAELYDPNAQEQYIDNTKPALYLAGDSTCMYYNANKQSQQGGPIQGWGYELPKYFSSNVS
IYNHAMAGRSSKKFYDEGRFATIVQNLKKGDFVAIQFAINDAGKSYADRYAPLCGNVDNP
SSGSYEWYMTSFIKDTKAKGATPILMSCTLGLKAYKNGRFTGSYTEYADACKKLAAKYSV
PYVDVNGAMVNYYNSIGYDNAAKLHIDTTHFNETGAPVIAQLIANAIKSANISGLSNYVK
Download sequence
Identical sequences E6UFF4
WP_013497232.1.49193 WP_013497232.1.63498 gi|317055207|ref|YP_004103674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]