SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055280|ref|YP_004103747.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055280|ref|YP_004103747.1|
Domain Number 1 Region: 32-365
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.53e-77
Family beta-glycanases 0.000000403
Further Details:      
 
Domain Number 2 Region: 542-601
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000876
Family Type I dockerin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055280|ref|YP_004103747.1|
Sequence length 611
Comment cellulase [Ruminococcus albus 7]
Sequence
MKAYFKKILSLVTAGIITASALPFVSAQAKDVSSMTAVEIAKDMGLGWNLGNTLEAHDGT
NHKKMGLESETFWGNPKASKALFDAVKAKGFRTIRIPVTWYPHADANYNIDTAWMNRVKQ
VVDWAVDENTYVILNIHHEEWNTPTNANYAAASKELKAFWKQIATEFRDYDRHLIFEGMN
EPRNYGGAHEWDGGTDDMRKVINKLDKDFVDTVRSTGGKNKTRCLMIPTYAASSTTVAMR
ALSIPDDPNVMVSIHAYSPYNFTMNTGSGATSVFGSAQENELKQLFNNINSIFLSNGKAV
VIGEFSSSNKNNTDERVKWAKSYATLAKQKGIPIVLWDNNSPKDNYNNGEGHGYINRKTL
AWYSTAEPVVDSLVKNYYGSSVSKTDLSKCKAVLSQTKYFYDGTQHKPSVTVTYNGKTLT
NGTDYTAAYSGGKAIGTGTVTLTGKGSYTGTVKLTFTVAEKTIGDCKITLSQNSYTYDGN
EHKPAVTVTFEGKRLNEGSDYTIAYENCRNIGDAYVTVTGTGSFKGSSKVRYCIDPADLS
GYKLGDVNFDSKITVTDVTLTSAQVKAKIFMSESRRRAADINGDGRVNVSDLSLMAAHVK
SKKSLPDKNIA
Download sequence
Identical sequences E6UG86 Q9LCC5
WP_013497304.1.49193 WP_013497304.1.63498 gi|317055280|ref|YP_004103747.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]