SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055439|ref|YP_004103906.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055439|ref|YP_004103906.1|
Domain Number 1 Region: 831-931
Classification Level Classification E-value
Superfamily EF-hand 0.0000063
Family Calmodulin-like 0.044
Further Details:      
 
Domain Number 2 Region: 756-820
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000785
Family Type I dockerin domain 0.0043
Further Details:      
 
Weak hits

Sequence:  gi|317055439|ref|YP_004103906.1|
Domain Number - Region: 47-83
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00961
Family Type I dockerin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317055439|ref|YP_004103906.1|
Sequence length 939
Comment hypothetical protein Rumal_0733 [Ruminococcus albus 7]
Sequence
MTNSKKVISFIMSLVALAATPRFAGINASAEKYKYDGRNGAYQRVDFYYNHSTDYNRTIE
CDINNDGDTDYYDVKLLEETVNRFGYDGNLAKNNKISVDSLISGTDTQKFEKTLSQAYDL
LKYDRNDNGRSEDFYKKFDVNGDNFIDSNDIIKLLEFVQKDYHFVVNTGEFSAVLFGTND
NLKTEARLVVPAEIVFHKDGKSVILPVMEIDKETFQNYHQLNKIEIPDYIQPFTNHYYFD
ENGNLSDKKLLDTNGKVTASTYLRIDDNAFANCENLANVSLPQNVRLSNKNVFSGSDNFL
DQHLYKDTSNGAVVLYDHVDGVSGDESKYGDKTTAILVELGNSISYDGTLDIAGINADTR
VYQDNYEKKITPVKVNVVNKLDQFVKDNKAVTDIKDIKLPDDVYLEESVFSKCVNCEKIN
GNEYTKLVENSAENKEVLDTISRYLSSFDGTLFIMGAVDAKANEIIKSFELDDNCTSFDK
VKAVAKYVVQKNKYRQYNDTTANINDYFDSNDTIYPSLKNEYNTSDQDRESIYKMATPFF
GKTTTCGSFSFLGSVLLDKLGVDNFSLGIGYSSMVENKKTHQVEEIVAAWGHSTINYYNN
ETKRWYNLDLSILSGFTSTSDADIINVIDSIKFDVITGKPSSDYKLNKKNEVIKGLCGTA
YRTVRNTTAGSNNSDVNLAVNSCFGYFTESSAKRQMTDDYSYVKVVGTENYPEKMKVELF
SIKDKNNENKWINVNELEKLLRLSETLEVVNIHEFYNLGDVNYDKRFNSADIDMINEYLS
GNNDFSILQKNLASIDYDNNKVINEDDIDALENLIQKKIHVVQEDTGLRPESFKKYDIDG
DSDLDEDDIDDLKMYINYYDTEEGVKQEETGLRPESFNKYDIDANGILNSEDIYDLEAYI
SKYVLLGDEVYKIENFSDFNGDGYVDSNDVAILRAAFNS
Download sequence
Identical sequences E6UI19
gi|317055439|ref|YP_004103906.1| WP_013497458.1.49193 WP_013497458.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]