SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055470|ref|YP_004103937.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055470|ref|YP_004103937.1|
Domain Number 1 Region: 314-383
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000118
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055470|ref|YP_004103937.1|
Sequence length 385
Comment hypothetical protein Rumal_0768 [Ruminococcus albus 7]
Sequence
MNKRRFFGVITAAAMIVSSMSISAGDMDTSIVASADEWYCAGNTCDPLHDTSRDIQKEGV
GNPLGFGERNTPANASTAEIRAINHNMTVQEVKYALYKEIDEHWDLISTRLGQPEREKVY
ALFLGLGTRESTLGEGKIGSDHETAYEDGWGVNSAHAYGTLQTAVTAFADCNPKFMPEDN
VPEMFQYSFTESNFYDCIISNHMGIRKILHFAEICINEEGMHGYQVIRNSLKGFNTGWCY
MAEDDGAYKTYADEICSMAQFYYNEGHLYDNVFTWTSAGGNMEKYRTADRWDWWGDTEPS
MAPITESNIPDNPKAVYGDANCDGKVDISDFVLIKQTLSAPSKYKLTEQGKINADCSGSG
DGITDADAVAVRKYILRMIDTLPEV
Download sequence
Identical sequences E6UI50
gi|317055470|ref|YP_004103937.1| WP_013497486.1.49193 WP_013497486.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]