SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055557|ref|YP_004104024.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055557|ref|YP_004104024.1|
Domain Number 1 Region: 160-492
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.44e-61
Family beta-glycanases 0.00029
Further Details:      
 
Domain Number 2 Region: 28-145
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000227
Family Family 6 carbohydrate binding module, CBM6 0.025
Further Details:      
 
Domain Number 3 Region: 498-573
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000235
Family Type I dockerin domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055557|ref|YP_004104024.1|
Sequence length 575
Comment mannan endo-1,4-beta-mannosidase [Ruminococcus albus 7]
Sequence
MWKKTLAFTAALGILFQTIPFCTATAAEIRYEAEDAALTGKLECISESSASGGKVVGKFA
NSDDVITFTVNIPADGAYDLIINSMGYGGDKTNKISIDGTYVGTFVTKAEVYNDAVLSRV
IMKAGTHKISITKSWGWIAVDYLKIIPAETIPDSAYQVSKTLSDPNATAETKALFSYLCD
GYGKQVLSGQVADDGLDSNEFKAIYEVTGKKPAILGLDMMRYTPSRNAFGDPNFKAVERA
VDFHNENGIVTFCWHWNSPGMYLKSGNDEENGNPRWWGGFYTRNTTIDIEAIMNGKDKKG
LEAIDADIAGIAKQLLRLQDAGVPVLWRPLHEASGGWFWWGAKGAEAYKKLYIYLYDQLT
NKYGCHNLIWVWNGQNPNWYPGDKYVDVIGEDLYLDKHSYSASASKFSEILEYSKGKKMI
ALSENGVVFDIDNVIASGTKWAWFGTWNGNFITKNGKFSDEYTEAYVLKKTYQSKYVITL
DELPDWSTYSAGTTPMSYYIAGDANCDGTVDLADVVLVLKVISDPGKYGEKGTNATHITV
QGAKNADVYERGSGLTSQDEIEIQRYLLKMVHSLK
Download sequence
Identical sequences E6UIT8
gi|317055557|ref|YP_004104024.1| WP_013497568.1.49193 WP_013497568.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]