SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055651|ref|YP_004104118.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055651|ref|YP_004104118.1|
Domain Number 1 Region: 60-119
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000392
Family Type I dockerin domain 0.0018
Further Details:      
 
Domain Number 2 Region: 501-590,654-751
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000383
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number 3 Region: 833-922,986-1083
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000103
Family Fibronectin type III 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|317055651|ref|YP_004104118.1|
Domain Number - Region: 335-420
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000102
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number - Region: 1109-1150
Classification Level Classification E-value
Superfamily SH3-domain 0.0183
Family SH3-domain 0.0082
Further Details:      
 
Domain Number - Region: 943-1000
Classification Level Classification E-value
Superfamily SH3-domain 0.0264
Family SH3-domain 0.0088
Further Details:      
 
Domain Number - Region: 445-502
Classification Level Classification E-value
Superfamily SH3-domain 0.0396
Family SH3-domain 0.0088
Further Details:      
 
Domain Number - Region: 611-667
Classification Level Classification E-value
Superfamily SH3-domain 0.0476
Family SH3-domain 0.0088
Further Details:      
 
Domain Number - Region: 777-833
Classification Level Classification E-value
Superfamily SH3-domain 0.0476
Family SH3-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055651|ref|YP_004104118.1|
Sequence length 1400
Comment hypothetical protein Rumal_0958 [Ruminococcus albus 7]
Sequence
MRCKKILAAAVSLAIAAGQLSVGAFADNSENSDAASAASADSNTTGDQDFSPYAEGDKPY
AAGDINGDGKIDITDVVKAAAHIKTAKSLNEKGLKAADANADGKVNITDLGLLAGQVKGK
RRIEVYTDLPVVKNPRDMQQNVKLIEFNVDKDTKSVSWNAAADMDTYSVKFTNGDKTKSF
DTHSLKADIPYDMFKDGKLTVEIAPLRYVMTEDGIRTKDYGDTTGYLLKIKPGTINGSIT
VTDNNGKAKIDWLAADFASGYHVYDLTNTASDGKPKLIADTDTDQLITDFPKSGTVKLLI
VPFNSVGEAEGANAEMTGGTVTKQDPVANLAAPTFNSYFYNSDTTTATLMWNAVSGAEGY
EASIQIDGKWKAYDAKTARSYKFTNLAQRTGFKTRVRAYKTVNGQKAYGSYSTTVTVVTD
GYVKCTTATPIYANASTGSTKLGNLYVGNTVMQTDLPANGWTKIFLPNSNGTQIGYVPTS
CVSADSNTQTEQKADLAAPTFNSYFYNSDTTTATLMWNAVSGAEGYEASIQIDGKWIAYD
AKTARSYKFTNLAQRTGFKTRVRAYKTVNGQKAYGSYSTTVTVVTDGYVKCTTATPIYAN
ASTGSTKLGNLYVGNTVMQTDLPANGWTKIFLPNSNGTQIGYVPTSCVSADTNTQTEQKA
DLAAPTFNSYFYNSDTTTATLMWNAVSGAEGYEASIQIDGKWKAYDAKTARSYKFTNLAQ
RTGFKTRVRAYKTVNGQKAYGSYSTTVTVVTDGYVKCTTATPIYANASTGSTKLGNLYVG
NTVMQTDLPANGWTKIFLPNSNGTQIGYVPTSCVSADTNTQTEQKADLAAPTFNSYFYNS
DTTTATLMWNAVSGAEGYEASIQIDGKWKAYDAKTAKSYKFTNLAQRTGFKTRVRAYKTV
NGQKAYGSYSTTVTVVTDGYVKCTTATPIYANASTGSTKLGNLYVGNTVMQTDLPTNGWT
KIFLPNSNGTQIGYVPTSCVSADSNTQTEQKADLAAPTFNSYFYNSDTTTATLMWNAVSG
AEGYEASIQIDGKWKAYDAKTARSYKFTNLAQRTGFKTRVRAYKTVNGQKAYGSYSTTVT
VVTDGYVKCTTATPIYANASTGSTKLGNLYVGNTVMQTDLPANGWTKIFLPNSNGTQVGY
VPTSCVKNYANSGLTVINQDGYLGGNPAVLGCEETALASVLNYQFGINVSKNTLIDYYMP
EQAFYNGAVNVDPNYCFWGSPYRMEGSVGYGCYAPLVAQSAHQYLNYIGVRNSYNIALNT
DYYTGNNVNKLKFDPGKLDLGNTAVSGGLDINGLKTEIDKGNNPIVWYSEVEPYAVCTQT
ITAGQKYSNPGSGTYNFTWYGRQHTAVLTGYDDANNCFILGNVENFDSSSYYGKVQTMSY
DFFMDTYTKLGRQSLIITKK
Download sequence
Identical sequences E6UBD4
gi|317055651|ref|YP_004104118.1| WP_013497662.1.49193 WP_013497662.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]