SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055739|ref|YP_004104206.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055739|ref|YP_004104206.1|
Domain Number 1 Region: 301-626
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.19e-58
Family alpha-L-arabinanase-like 0.0051
Further Details:      
 
Domain Number 2 Region: 38-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.12e-28
Family CBM22 0.0000218
Further Details:      
 
Domain Number 3 Region: 209-273
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000379
Family Type I dockerin domain 0.0016
Further Details:      
 
Domain Number 4 Region: 625-743
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000476
Family Family 6 carbohydrate binding module, CBM6 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317055739|ref|YP_004104206.1|
Sequence length 744
Comment carbohydrate-binding CenC domain-containing protein [Ruminococcus albus 7]
Sequence
MKLKKTITRLCTATLSSAVLLSTTSALPVSAAMSPDSNGFYYHDTFEDSSGNWEIRGSGE
ILLSGRHPFKGTNALLIKDRTSAWQGAQMALDTSTFIPGKSYSFNVFVDYEEGESTQNFL
LSMQYTDSTGTVKYLHLAEGSTSRGQYLQLSNPSFQIPSDASDVYLYVETTDVYGNFYID
EAIVAADGVTIDSSGASQGYTAPKTPGDIRGDVNQDGRINLADLILAKRGMYSGFPNKQS
QKAADIDKSGTVDNDDINYLQDFILKKINSFPKINKIDFNEMAGKFGNVSLATGYKKSNE
NNPLISQYFGADPGVMEYNGRVYVFMTDDHLLYSNGQLKDIEYGTINCIRCISSDDLVNW
TDHGLINAAGSNGLCRWGGNSWAPTACHKKINGKEKFFLYFANGGNGIAVLEADSPTGPW
KDPIGKALISRSTPNCGNVEWLFDPAVLVDDDGTGYLYFGGGVPSGQNAHPKTARCVKLG
SDMTSIVGTPQTIDPPYLFEDSGIHKFNGKYYYSYCSNFSTGGNQYGLSGGAIQYMVSDY
PLGPFTYVGEAFKGIGTFFGTGGNNHHTIFKFNNQWYLFYHAQYLQDNMGLKGGYRSTHI
DKVTINSNGTIQAITGTKKGVSQIKSFDPFRTQRAATFSHQGGITISGSGDYSTVQAKKG
SWYRVSGVDCGSGAETMTFKASSNTGCIVKVCTGSANGTVVSYVEIPAGSSMQEITVPVQ
GLSGKNDLYFVFNNNASVDSWKLD
Download sequence
Identical sequences E6UC21
gi|317055739|ref|YP_004104206.1| WP_013497750.1.49193 WP_013497750.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]