SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055764|ref|YP_004104231.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055764|ref|YP_004104231.1|
Domain Number 1 Region: 576-635
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000419
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317055764|ref|YP_004104231.1|
Sequence length 641
Comment hypothetical protein Rumal_1071 [Ruminococcus albus 7]
Sequence
MKRKHRMVSLLTSAAMLWVMQPSGIVTVSADMAGEFSENHSYVGGTVNTPILRSTDIQPI
EITEQPSAVSDVYYNEDVTLTAKADNANTARWYCRSLNGIHPCGKLTALDESGLTSVSVK
ADGKTYFCRFSDGKEYADTQTVSACFIPAFTVNETSMTFIGGEDAEISIPCDYDHEHPCD
HIITDEWIMRKNGTDVTITSSDKYIIKGSRLTIKDISAEESSCILRHIITEHGSYYSKGI
NISVVDGDPDKSISSFELEGIGKLFIGDKAPGISDISTMSEKYTIESISWTGVDANGYIV
SPNPAYSISLKAADGYMFRYGGNGDIKGHMDDIMLTAYGVPDTYTDKLTVSRTYDNHTYL
TAPKDFIALEQYDLSACRYNYVDIQLKVNFSCPDQHSEKHAVKSFTDAHYSAGYHLPEGL
TMDSMGHITGMLTAPEGVQPFLVYIESTSGEAYLMDCTFTVNEHEHQYVKDTDPETGEAV
MVCSGTEYCGAEPIPVPQEPHNAHTWGQWISDNDNTHSCTCTECSEIKTESHSFDDGVIT
KEASKEEKGIIVYTCTECGHQITEEYEYDGNTDDDYILGDANGDGMINVSDIAIAAAYVK
GRKPLDDKSQKRADTNNDGKVNISDISKIAAHVKGKKLLAK
Download sequence
Identical sequences E6UCJ2
gi|317055764|ref|YP_004104231.1| WP_013497775.1.49193 WP_013497775.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]