SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055773|ref|YP_004104240.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055773|ref|YP_004104240.1|
Domain Number 1 Region: 93-341
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.59e-39
Family Carboxylesterase 0.0000563
Further Details:      
 
Domain Number 2 Region: 443-594
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-28
Family CBM22 0.0011
Further Details:      
 
Domain Number 3 Region: 666-839
Classification Level Classification E-value
Superfamily SGNH hydrolase 2.44e-22
Family TAP-like 0.026
Further Details:      
 
Domain Number 4 Region: 358-428
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000108
Family Type I dockerin domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055773|ref|YP_004104240.1|
Sequence length 982
Comment carbohydrate-binding CenC domain-containing protein [Ruminococcus albus 7]
Sequence
MKLSRTKKILSATVSLMMVAASLPFPANAAGNFWGNNGGQDWSGFAGGFDTTGNEVIGSD
AGNGGNAQSGLNAKIKNDMPTTVPSDLETSSQCKVENKSYYCKYTGKQKKCNVILPPNYN
PSKKYPVMFILHGIMGSENDMVSGNGVQELMTSLMSSGKAEEFIVVTPNMFTSKTMNGPS
GINQQTCAEYDNFLYDVTDSLLPFIKENYPIKEGRENTAITGFSMGGREAIYCGLMRPDV
FGYVGGACPAPGITPGSDRYMDHPGCMQESEMKFRNVGPEPEVFMITGGTNDDVVGTFPK
QYSDILTRNGVDHVYQSIPGGGHNANSVKPHLYTFMRYAFKSDGSSSQSSGSGKKAASLY
GDANLDGKVDMKDAVLIRQAVAAPGKYKLTGQGSVNADVFNVGDGITADDANAIKNYILG
HISSLPIKEVTDDPSGQTDTPSGVVLSNDFNSGVGNWAGRGAASVAATDNAYYGTSGKSM
YVSGRTAEWNGAAINLGSDFKAGQTYSISLAALQTSGGSSEIQVSLQQSGGYGSAVYTHI
ASAECKSGVWTKIENTSFTIPDNAGDITLYVETVQGSGDLTDFYIDNVQIAAAGTKSSVK
TGGTGKVPGSASSSGSGTGTEVDHSKWDNYKETASSQYINFYKSSIKHMGNTYRLSQKLS
AAENGSPLTVAYLGGSITEGKNYTTPFSSYLKNTFAKGSFKEINAGLSGTSSVVGLVRSE
AQIVSQKPDIIFLEFSVNDHEDIMYKKCFESCIKKFLDMPNAPAVCVLITRAKGGFSSQN
QMYPIGKNFDIPVISMDDALTKAFNSGFLNTGDYYTDEYHPHQKGGQLIADCMAYYVRQA
MKSQNSSSSYTQPTSYVYGAEYADTVNVDPKNLTNFSAGSWTSGYGYNNSGLNYSYTLNG
SNPMKFKTQGKGLIIVFKANSSGMGSINVTVNGKTTKISGNKQYTWGGPDAELGYYQSTS
GDLDVSISGSGQFTIWGIGLIK
Download sequence
Identical sequences E6UCK1
gi|317055773|ref|YP_004104240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]