SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055775|ref|YP_004104242.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055775|ref|YP_004104242.1|
Domain Number 1 Region: 1-372
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.11e-77
Family beta-glycanases 0.000000618
Further Details:      
 
Domain Number 2 Region: 437-588
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.57e-30
Family CBM4/9 0.0039
Further Details:      
 
Domain Number 3 Region: 620-752
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.02e-28
Family CBM4/9 0.0033
Further Details:      
 
Domain Number 4 Region: 383-439
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000353
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055775|ref|YP_004104242.1|
Sequence length 753
Comment cellulase [Ruminococcus albus 7]
Sequence
MKTKSKSALTLSMVCAMALSCMPFVEPTRAEAAFDKDAKQTVADMGLGWNLGNSLDSYSG
TTIGGNRGSTSSETAWGNPATTKAMIDMVKESGVKTVRVPVTWYEHMDPYTYKIDDVWMN
RVEEVVNYVLEDDMYCILNVHHDTGEKGWLKANSKDLQKKEAMFRSIWEQVSENFEDYGD
KLVFEGFNEILDESSNQWWNPSSEACPISNELNQIFVDVVRGSGGNNAKRNLICNTYCAG
ANNEITSQFVLPKDTVSNRLIVEAHVYQPFEFTHESYPEITTWTSSPLDMVLNNLNSTFA
QKGIPVIIGEFGCANKNNMDEITSWAKYLVEKCTGYGMGCIWWDNGSQYKIYNRRTLKVS
QPELLNAMLEAAGSDVPASAQKFVRGDINGDGKLNDTDLEMLRNYLLKKTVKISDKADIN
MDGKVTMADFVQMNKAILNPDPASDPRNLCANEDNWASWTDTSNGGQGEMFFMDNGVSMQ
VDKGGKNEWDAQFFYDAITLEQGAKYQISFDYVSDSPQTTTFIVNQGHDDYLPYYLDSLN
WTTNVQHYKATFDFTSKTDNMCRVTYNLGGSGVNVPYKATITNLSLIKLSGGGSSSSSSS
STQSGTSASTGTNLAADASKFSSWANTEGGASASFKSLSNGLQISVKNSGTEEWYVQGIY
PGIKFEKGATYEISFDHQADKAVKFGVKLQQNYEPYGQYSNEPVYASTQKQHYSAEFTMT
DPTDDNTACVFNCGALNTNATITITDLVIKKIS
Download sequence
Identical sequences E6UCK3 Q9LCC4
WP_013497786.1.49193 WP_013497786.1.63498 gi|317055775|ref|YP_004104242.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]