SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317055776|ref|YP_004104243.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317055776|ref|YP_004104243.1|
Domain Number 1 Region: 42-81,150-452,498-630
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 7.29e-113
Family Cellulases catalytic domain 0.000000124
Further Details:      
 
Domain Number 2 Region: 669-833
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.88e-33
Family Cellulose-binding domain family III 0.00091
Further Details:      
 
Domain Number 3 Region: 853-914
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000123
Family Type I dockerin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317055776|ref|YP_004104243.1|
Sequence length 936
Comment cellulase [Ruminococcus albus 7]
Sequence
MGKGKFLKRSLAGLSAAAMMFTGNTAATVTAAVIDKENPNNYHNYAEALQLALCFYDANK
CGDEVADDGYYSWRANCHVKDGYIPLQPMSPMPEIGKGKTDDQLQEDQGLGAGDDGKTKP
NLGDTDPSLYAGVNMSQNFIDKNKKYLDPDGDGTLDLTGGWHDAGDHVKFGLPGSYSAST
VGWGYYEFRDSYKELGLDKHVEDELHWINDYFMKVTFMDDDDNVIAYCYQVGEGNNDHNY
WCPPELQVEDTMVASSSCAVKRPAYFATEEMPASDQCAGAAASLAINYLNFKDTEPEYAK
KSLKYAKALYDFAVKTHVEEWKPGEVPSCSSLGYDGGFYTSSYDYDELAWAAVWLYYCTE
DYDYINDIIAVDETTTNAKGAHPYTGYMKRIITDTGNCWQNIWVHCWDTVWGGVFAKLAP
VTNTARDWYIFRYNLEFWSGCAESVDSSDWGYEPVHGHKYFGMDDYLWNTKMTADQIADL
PISETSGDFIAKSPKGWAVVSGYGSARYNTAAGLCACVYAKTTNDQTFLPWARAQMEYIL
GKNPMGYAYEVGYGNNFASHPHHRSSHCSATQSMDDPITQVHTLWGALVGGPDLKDNHVD
ETKDYIYNEVTDDYNAGFCGDLAGLYHYYGRKGGIDAKENSIIKNFDMSSNAKGFDQVDE
NGNPLPVGYFVSGGKAQEKKDGIQLKVVLHNRTVDPPRFECNVKARYFFNIKELLDAGYG
IDYITARIDYDQVAGYSNNKSHAELSDPVKYDDKGTYYVDITWKDCKFYGSRVYQFALTT
KMDPEKFVYPEWDSSNDYSYSDLVSFEDDNSAAAITDKIALYADGKLIWGSEPDGTTPET
FVNDEPTENPSAKILYGDVNCDGKVNMADVTAIYQYGNNKRKYPLTAQGMRNADCVDAGK
GLTNDDAKAIKAVVISALKVSDLPISSTALKKVSVK
Download sequence
Identical sequences E6UCK4
WP_013497787.1.49193 WP_013497787.1.63498 gi|317055776|ref|YP_004104243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]