SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056049|ref|YP_004104516.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056049|ref|YP_004104516.1|
Domain Number 1 Region: 188-522
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.95e-58
Family beta-glycanases 0.00059
Further Details:      
 
Domain Number 2 Region: 533-601
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000569
Family Type I dockerin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 68-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000697
Family Family 6 carbohydrate binding module, CBM6 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317056049|ref|YP_004104516.1|
Sequence length 603
Comment mannan endo-1,4-beta-mannosidase [Ruminococcus albus 7]
Sequence
MKRCVLNVMSAAAAVILACSAVTPAVTAFAENSSGSAQVYEFENGRTSGGKIFANGTEGL
KRGGDWSDDTDLSNFSGKGFSYLDQKGTTVSVEVEVPADGLYQLTFCYCQPSDRNKKVQY
LNVNGVNQGEVSFPYNESFAETSGGIVLLNKGKNTIELEGYWGYTYFDYLKIAPAPEHIS
KLSPTAELSNPNASDSAKRLYSYLRDQYGKHIIAGQQEYCGSHNYNSWNSPDVFIKDNEA
EFEYILDKTGKQPAIRGIDLLAYNTTSSWRDNAPERAIEWTNKYHGIATLTWHWNVPCEK
GSTETAFYVKSASATYTTFSITNALEEGTWENEVLMADIELIAGELKKLKDADVPVIWRP
LHEAEGGWFWWGAEGPEACKKLYRLLYDQLTNVYGLDNLIWEWTGYTFPTSSAWYPGDDV
VDIIGYDKYNAKDGLPNLSSISATFYSLVQSTDGQKMVAMSENDSIPSIENLKNERAYWL
YFCPWYMNYLTSEQNNPVDNLIDVYNSEYCITLDELPDLKNYPISGGEVTKAKVVYGDAN
CDGKVNISDLVLVKQHLASPKKYTLTAQGKANADVDNTGDGITASDAIKIQKYVAGIIKS
LGV
Download sequence
Identical sequences E6UFH8
WP_013498051.1.49193 WP_013498051.1.63498 gi|317056049|ref|YP_004104516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]