SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056050|ref|YP_004104517.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056050|ref|YP_004104517.1|
Domain Number 1 Region: 46-84,115-453,482-563
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.39e-107
Family Cellulases catalytic domain 0.00000017
Further Details:      
 
Domain Number 2 Region: 603-752
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.41e-19
Family Cellulose-binding domain family III 0.0012
Further Details:      
 
Domain Number 3 Region: 773-826
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000157
Family Type I dockerin domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317056050|ref|YP_004104517.1|
Sequence length 850
Comment cellulase [Ruminococcus albus 7]
Sequence
MKLKTRLISAAAGAVLALSQTAAMIPSVHAAGELKEAIENSSGVRYDFARALQYSMYFYD
ANMCGDDVEGNNRFEWRGNCHTYDSKVPLHPIEDWEGVNLTESQIKKYKSLLDPDGDGYV
DVAGGYHDAGDHVKFGMPENYAASTVGWGYYEFRDSYIKIGEQDHIETILRHFNDYLMKC
TFLDKNGDVVLHCYQVGDGDLDHKYWNSPEMDEMARSAFFLTPEKPQTDYAASAAASLAI
NYLNFKDTDKTYAQKSLKYAKALFKFAMDNPKDLSDNGDGPKGYYRSSKWEDDYCWAAAW
LYKITGDHMYLEEIYPNYDFYAAPCYVHCWNDVWGGVQCILGEICRDTPYTKGEYVYPDF
IEEFKKAANKSPYEQMNCWESVEKAINTYMTGGVGKVTPQGYWWLDTWGSARYNTAAQLE
ALVYTKYNGDKPNKYSDWAKSQMEYIMGNNDITYLERIEENNAAEKNGEPKPWSDDELHG
SRSFIVGFDENSVQYPHHRASSGLTKCEDPDPQRYVLFGALAGGPDNQDRHNDITKDWIY
NEVTIDYNAAFVGASAGLYKYYGTSKMAPTKNFPPKPTFSGTNGGSTSNECWVTACGIDD
LHSDGAGVTKISLYVMTASTKKVEDLSVRYYFSTKGMKDPNNIKVSELYDQAAVEAAPAN
GTISGPYKYDKMNDMYYAEIKWDDYNIANSGKKYQFTVGLYYGDMWDPTDDPSYKDLKIY
EVDDAFFATGTEVKTENICVYSGDKLVGGIEPDGSKPEFESESENSSAPATYGDANCDGK
VDMADAVLMAQYLKYPKKYPITAAGLKNADCVDSDGINTLDVRAVQLVAVKALSQKSLPS
TKSKINSIGK
Download sequence
Identical sequences E6UFH9
gi|317056050|ref|YP_004104517.1| WP_013498052.1.49193 WP_013498052.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]