SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056112|ref|YP_004104579.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056112|ref|YP_004104579.1|
Domain Number 1 Region: 104-212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.96e-20
Family alpha-D-mannose-specific plant lectins 0.00052
Further Details:      
 
Domain Number 2 Region: 33-87
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000641
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|317056112|ref|YP_004104579.1|
Sequence length 397
Comment Curculin domain-containing protein (mannose-binding) lectin [Ruminococcus albus 7]
Sequence
MTNFNKKLASALAVVTLFTCASSTCLTASASNFIGDVNNDNRVDNNDVNLLQRYVVYKDV
SINRGNADINGDGNVNIADVVSLQKMTNNNRGSSISCTSKNNTLLSKGQQLTSPDGKYFA
IMQKDGNFVVYYKTPVKNIVIWATYTQNNPGAYLALQQDGNLVVYNSSSRWIWQSKTSNR
PFSDYILSLGNDGILRLRRKKDGRQLWSSPNNYPNLISQAQSRVKARHQYSSIDEAAKDF
IIAYNGMSVNQNREYGAGIVKVGNKYTFNHIVWGPVRNSVNGELGDDNWNEINSSDAVAY
VHTHGKVWNGDKANLVFSPDDMNVVDDSDHLQYAYLGNEHGDVYRYKKNSTHYSYNDYRN
NGLASGDLIATYPQYSYLYSNDTSFRQNNNPGIYRLG
Download sequence
Identical sequences E6UGA7
WP_013498114.1.49193 WP_013498114.1.63498 gi|317056112|ref|YP_004104579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]