SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056128|ref|YP_004104595.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056128|ref|YP_004104595.1|
Domain Number 1 Region: 153-188,238-382,518-625
Classification Level Classification E-value
Superfamily Subtilisin-like 4.97e-50
Family Subtilases 0.0019
Further Details:      
 
Domain Number 2 Region: 1233-1293
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000363
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317056128|ref|YP_004104595.1|
Sequence length 1297
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Ruminococcus albus 7]
Sequence
MKKKETIGRIAGLASAMTVLLSTVVPAAADVLPQKHDYSDDEQLKVIVKLKGDPILADNE
GVGIDYLDTQAAQCRRIQLENERMNVFAAVQKLYPDAEQEFTYDTIFNGFSCTVPESIID
DIGRMYNVDDVVLSGSIMVPELETANPESGLDNFLEDTGLTGEGKVIAVIDTELNIDHDM
FKPLADDIKTKLSYEDVVDIINTKGLSHDIDPEKAFRSSKVPFAVNYADEKNLYSVKRSR
NIMYHGSHVSGIAAGNRAENNGKPIHGTAPDSQLIFFKASSDEDNSSLNDDAIVAGVEDA
VKLGADVINMSFGGRTRSQKLQKIFDEVFDTALEAGVMIVASAGNSGTAFHTPDHADVST
ISSPASMESAFSVAAGWAHMNYASMFALPDGTKLYFTDHSALSLEGKVDYVYCGKATEFD
NNNYTDKLKGKLVLLDYAGYDRKDMKNINDRISATQADGIIYFDSMGEEVLVDPDDFLRI
CYLIEIDNKTAQKMIKAKNKRIDFDVPGEIIGTETHLCDFTSSGIPGNFEIKPEIAGYGI
LKSAGCDGTSSYSAMRGTSMSSPYVAGCAALASNWLDKNGIDVSGADRVQMIKNVMMNSA
TPLNIDDVYQSPRKQGAGMVNMTNLEKTKVIMTGSGGKACISQGEIDGNSFTFDVTMKNI
SDKTVMFTDAYAEFTTDKVDENGMIDYVPEALKVNAVLPDDMLAIEAGDEKTFTITAEID
ADNAAAKDEVFTNGWFVDGYICLSGSVQCCDISIPIVGYRGDWYGLPITEGEMNAENASK
ESNFMFSNICSKRIILPSCVSLAELIRAQTMPGANDTEDDKAAVEAYEKACIDAAKYEYC
YSPNGDGLADVMSYSYYVYRDSCQNYIDVIDKDGNVVVHTTYMFLVNDSINECTSVVEVP
LDDGRYSIKSEIVIKADNTNGRKEEHEFTMTVDTKAPVVSDIRLTEKNGRKILSLKAKDE
RLDGVYIIGNGNGKVTNGSDDVQIKPKMLTAAFEALVSNIHYIDVIPKQDKVFTKSTPAY
FDDMLKAYLSGDSSINKGFFDVVPSSVDENGEMMFEYDVTDLTDYTITVADRAFNMTKYS
PKAPFIHPLADTITAKIGSRLKMNEVVDVECEGEITEQGWEILLPDDKWRPFDLKSYVKA
NYNNALIRYYAVSGGYRSTSNSMRIKVSDAYRMNMEVFVDDELNYSATVTPQHHTFDLST
LAKEHRIELTSEGFIPRTIILDPADKLAADLYLCKQGDVNGDGVINVTDVSMAAAHIKGV
KSIGGYEQKVADVNANGSLNVTDISKLAAKVKGVRNF
Download sequence
Identical sequences E6UGC3
WP_013498129.1.49193 WP_013498129.1.63498 gi|317056128|ref|YP_004104595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]