SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056154|ref|YP_004104621.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056154|ref|YP_004104621.1|
Domain Number 1 Region: 47-330
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.14e-62
Family alpha-L-arabinanase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 346-552
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-38
Family Beta-D-xylosidase C-terminal domain-like 0.0083
Further Details:      
 
Domain Number 3 Region: 989-1232
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.55e-38
Family Carboxylesterase 0.0000839
Further Details:      
 
Domain Number 4 Region: 567-716
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.34e-31
Family CBM22 0.0000761
Further Details:      
 
Domain Number 5 Region: 738-886
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.79e-30
Family CBM22 0.00011
Further Details:      
 
Domain Number 6 Region: 896-960
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000235
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317056154|ref|YP_004104621.1|
Sequence length 1233
Comment glycoside hydrolase family protein [Ruminococcus albus 7]
Sequence
MSRPKPITQRLLSVLSSAALAASCMAAACGEMPVTTAHALETGQVANPIIWADVPDPDII
RVGDTYYMVSTTMYFSPGVPVMKSKDLVSWEICSYVYDTMADGAKQTLSNGQHDYSHGSW
AASLRYHKGTFFVFFGSYGTNKSYIYKTNDIENGSWTKSEISGMYHDASILFDDDGRNYL
VYGGDGNIKIKELNSQMTGFAYGAQERTIIRTGLSGLAGEGAHVQKINGWYYVFLIAWPS
GSKRIELCYRSKSLTGTFEGKTVLDSGLGTYGSGVAQGGIVDTPDGDWYGLLFQDHGAVG
RIPVLVPVTWQNDWPIMGVNGKAPVVLDIPGDHKGTQLAVDDEFVYSNNKLKPEWQWNHN
PDNRYWSLTERPGWLRLKNGYTAKSIMNARNTLTMRTEGPSCSGIIKMDVSNMKPGDYAG
LSAFQYNYGNIGVRITDSGEKKIYMATNGNYGGNDVMNSADKIQEEVSFSGSTVFLKTEF
QFNTVDGNYNVSNNIDKVNFYYSLDGISWKKIGSQLSMTYDLKLFTGYRNAIFSYATKST
GGFVDVDYFDYERAEWNPPSVVEPDADGYLLHDTFENGIGKWSARGGCTAAVSTDSKYSG
SYSLSLSERTAAWNGGMRSLSTNIFVPGKSYAFSACFINREGPDTAEFKLTLQYDLNGQT
NYDKIAQETGDRGKYVQLYNSSYTIPSGATNLVLVAETTEENCDFYIDEVIAAPAGTKID
APSASVSQGNTSGTETSSYIFHDTFENGTDDWSARGGCTAAASSSAKYKGSKSLSLSGRS
GAWNGGQKSLSTSAFVPGKSYTFSACFANLEGSDTTEFKLTLQYDLNGETKYDKIAQAYA
DRGKFVQLYNPSYTIPSGAENLVLVAETTQELCDFYIDEIIAAPAGTKINRSAAPVTGDV
DLDGNITIKDLIELKKGMIRGINNSASKYNADIDRSGAVDENDEALLRSYLLGEIKEFPV
INTHLSMKDFTAKVQNGIVEKEPDSANSSKNGVAYGEILKKSYYSTTCNRQKDVNILLPP
NYDPNKQYPVMYILHGYYEGIDRMLTKGNADMHTREMIGNAIAEGAAKEMICVFPDVFSS
PTLRSCTGMDETNNQAYDNFINDLTKDLMPYIAKNFSIKTGQDNTAITGFSMGGRESLLI
GMKRPDLFGYIGAICPAPGVSGSFRWSGDDQPYFLMITAGSDDKTVYDNPKNYHSSFEKN
GVPHIWHYVNGGYHGDNCIRAHLYNFFRIAFKN
Download sequence
Identical sequences E6UGE9
WP_013498152.1.49193 WP_013498152.1.63498 gi|317056154|ref|YP_004104621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]