SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056160|ref|YP_004104627.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056160|ref|YP_004104627.1|
Domain Number 1 Region: 67-125
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000114
Family Type I dockerin domain 0.0017
Further Details:      
 
Domain Number 2 Region: 349-460
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000000561
Family Transglutaminase core 0.029
Further Details:      
 
Weak hits

Sequence:  gi|317056160|ref|YP_004104627.1|
Domain Number - Region: 241-316
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000155
Family Fibronectin type III 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317056160|ref|YP_004104627.1|
Sequence length 477
Comment type 1 dockerin [Ruminococcus albus 7]
Sequence
MTDISKKFCAAAAAMALVLSQTSVYAFADNNAQTVPADEIFFNADENTTADEDITESVAA
TEEEDYAAGDLNNDGKLNITDAAKVAAFIKAKINLNDKALKAADINEDGKINITDLSIMI
AEIKGIRVMNWLELLETVSDSSIVAKTTRFSKLPDIVSLRSIVKVDWTAVNGVDGYDVVI
SGADRSEKYQVKSNSINVNALRWSDDDIINIKVMPYTYYNTETRQGVKSFSDGYEGKLSI
KPENVTGLKAKSERNYVKLSWKAAADADVYNVYYTVNGKESFHGQTSELSRQINVPANKD
VSFRVLAVNLMGKSYVNADKSATAKVHTLPYYAKAEAVLDKVGWDLHKAFNWCIMPYAYY
INGEWLPRDGSPGMEWYADRGFDAHEGNCYVMAACFCEMAKMLGYDAHQISSGTLTSNGF
VDHSWVEIKNYNGTGKSYIFDPDFESELGRNGFAISYGDKGTLMYDISGSIKRVIMS
Download sequence
Identical sequences E6UGF5
gi|317056160|ref|YP_004104627.1| WP_013498158.1.49193 WP_013498158.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]