SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317056573|ref|YP_004105040.1| from Ruminococcus albus 7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317056573|ref|YP_004105040.1|
Domain Number 1 Region: 34-161,215-421
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.45e-45
Family alpha-L-arabinanase-like 0.00084
Further Details:      
 
Domain Number 2 Region: 567-706
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.13e-30
Family Ricin B-like 0.0078
Further Details:      
 
Domain Number 3 Region: 792-847
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000275
Family Type I dockerin domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317056573|ref|YP_004105040.1|
Sequence length 848
Comment Ricin B lectin [Ruminococcus albus 7]
Sequence
MKKSRIGALLIALSMSAAGMNTIFADAAGRRVSVHDPSIIKDNNGTYYVFGSHIDAAQSN
NLIDWDSFTNGYARTNNVEFGNLSQNLKKAFAWAGEDLEDCEGGFSVWAPDVIWNPEFKC
PDGSTGAYVMYFCTSSTYKRSVICYAWSKNIKGTYTFGDTLIYSGFYDNDSYVKSSTKSV
NRKYTTTNVDELISKGEVTYNNSWFNNHDFNNQLFPNAIDPTIYYGTDGKMYMTYGSWSG
GIFSLEINPKTGKVIHPKTGTTSDGRMVDSYFGTKIAGGYGKSGEGPFIEYNAETGYYYL
WTTYGGLFSTGGYNMRVFRSKSPQGPFVDAAGRQAVLSSNTNLDSVGLKVMGNYKFSTLD
RAYMACGHNSVLRDDDGQWYLIYHARFDDGSEFHQVRVHQMYFNADGWPVVTPFEYVGDQ
LSKDGYYDSDIVGKYEYINHGNATNGNIIGYKTIYLNSDGTISGDVSGTWKQSSSTADAT
LVIDGNTYKGYFYAGKNEKNKKVMSFTAVGSNNQTVWGAKNDQFNGNERAWTGDFTNSEY
DLVFNWDSVKNEDPGVSMKIGNTSLLSGVSYYITNKNSGLCLDLPEGKTANGTNIQQWAF
NGSFAQQFRLISEQDGWCRIASVGDESKVISVAYNTGADGTNVELAEYTGADNQLFKVVE
NNGYYAFLTKCSGAKSSLDVFEWSKENGGNISQYPYNSFDCQLFSVTPVCPAVNDGVYSF
RRVSDGKVTGNRTIKRLEDGRYTLTEDDGKSGTYTIKCNADGSYKLVTSDNKESSYIFEP
VAAKVSGPTYAKIIGDVDANGIVNDADAYMLQCYLLKLCSLKDTSQGDVNMDGKISMADF
VYLKQKLI
Download sequence
Identical sequences E6UAI4
WP_013498570.1.49193 WP_013498570.1.63498 gi|317056573|ref|YP_004105040.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]